KEGG   Rattus norvegicus (rat): 311661Help
Entry
311661            CDS       T01003                                 

Gene name
Zfp64
Definition
(RefSeq) zinc finger protein 64
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-H2C2_5 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 311661
NCBI-ProteinID: NP_001012093
RGD: 1307948
Ensembl: ENSRNOG00000012762
UniProt: Q5U2X9
Position
3q42
AA seq 678 aa AA seqDB search
MNVSGDGESFSGSVQIPGGTTVLVELTPDIHICGLCKQQFSNLDAFVAHKQSGCQLTTTP
VTAPSTVQFVSEETVPATPTQTATTTISSETQTITVAAPEFVFEHGYQTYLPTESTDDQT
ATVIALPTKTRTKKPTAPPAQKKLGCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCEVC
GKCFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYAS
RNSSQLTVHLRSHTGDAPFQCWLCSAKFKISSDLKRHMRVHSGEKPFKCDFCNVRCTMKG
NLKSHIRIKHSGNNFKCPHCDFLGDSKSTLRKHSRLHQSEHPEKCAECSYSCSSKAALRV
HERIHCTERPFKCSYCSFDTKQPSNLSKHMKKFHADTLKNEAPERKDSGRQSSRQVAKLD
AKKTFHCDICDASFMREDSLRSHKRQHSEYHSKNSDVTVVQLHLEPSKQPAAPLTVEHLQ
VPLQSSQVSQFNEGSVKIIVGHQVPQTNAIVQAAAAAVNIVPPALVAQTPEEIPGNGRLQ
ILRQVSLIAPPQSSGCPSEAAALSQPTVLLTTHDQTAGAALQQALIPTSPTETQEGTGNP
TFIASSGITCTDFEGLNALIQDGTTEVTVVSDGDQSIAVATTAPSIFSSQQELPKQTYSI
IHGAAHPALLCPADSIPD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgagtggagatggagaaagcttctccggatcggtgcaaatcccaggaggcacc
acagtgctggtagagctgacaccggacatccacatctgcggcctctgtaaacagcagttc
agcaatctcgatgcctttgtagcccacaagcagagcggctgccaactgaccaccacgccc
gtcacagcccccagcacggtccagtttgtgtcagaagagacagtgcctgccaccccgacc
cagactgccacaacgaccatcagttcagagactcagactatcacagttgcagctccggaa
ttcgtctttgaacatggctaccaaacttacctgcccacggaaagcaccgacgaccagaca
gccaccgtgatcgctctccccaccaagacacgcaccaaaaaacccacagcaccccctgct
cagaagaaactcggctgctgctatccaggttgccagttcaagacggcctacggcatgaag
gacatggagcggcacctgaagatccacaccggtgacaaaccccacaagtgcgaggtgtgc
gggaagtgcttcagccggaaggacaagctgaagacgcacatgcgctgccacacgggcgtc
aagccctacaagtgcaagacgtgcgactacgcggcggccgacagcagcagcctcaacaaa
cacctgcgcatccactcggatgagcgacccttcaagtgccagatctgtccctacgccagc
cgcaactccagccagctcaccgtgcacctgcgctcgcacacaggggacgcccccttccag
tgctggctctgtagtgccaagttcaaaatcagctcggacttgaaaaggcacatgcgcgtg
cactcgggggagaagcctttcaagtgcgatttctgcaatgtccgctgtaccatgaagggg
aacctcaagtcgcacatccgcatcaagcacagtgggaataacttcaagtgtccgcactgc
gacttcctgggtgacagcaaatccaccctgcggaaacacagccgcctgcaccagtccgag
cacccggagaagtgcgcggagtgcagctactcgtgttccagcaaggcggcgctgcgcgtg
cacgagcgcatccactgcaccgagcgcccgttcaagtgcagctactgcagcttcgatacc
aagcaacccagcaacctgagcaagcacatgaagaagttccacgcagacacgctcaagaat
gaggctccggagaggaaggacagcggcaggcagagcagccggcaggtggccaagctggat
gccaagaagacgttccactgtgacatctgtgacgcctcgttcatgcgggaggactcgctc
cgcagccacaaaaggcagcacagtgagtaccacagtaagaactcggacgtgacagtagta
cagcttcaccttgagcccagcaagcagccggctgcgcccctcaccgtagagcatctccag
gtccccctccagtccagccaggtgtcccagttcaacgaggggagtgtcaagatcatcgtg
gggcatcaggtgcctcagacgaacgccatcgtccaagcggctgcagctgccgtcaacatt
gtgccccccgccctggtagcccagaccccagaggagatcccggggaatggccggctacag
atccttcgccaggttagtctcatcgctccccctcagtcctccgggtgtcccagcgaagca
gctgccctgagtcagccgactgtcctactgaccacccatgatcagacggcgggggctgcc
ctgcagcaggccctgatccccacctccccgactgagacccaggaaggcaccggaaacccg
acgttcattgccagttctggcatcacgtgcacggacttcgaaggccttaacgctctgatt
caggacggaactacggaagtgactgtggtgagcgacggggaccagagcatcgcagtggcc
accacggcaccctccatattctcttcccaacaggagctgcctaagcagacttactccatc
atccacggggcggcgcaccctgccctgctctgcccagctgattccataccggattag

DBGET integrated database retrieval system