KEGG   Rattus norvegicus (rat): 311860
Entry
311860            CDS       T01003                                 

Gene name
Abl1, Abl
Definition
(RefSeq) ABL proto-oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04110  Cell cycle
rno04360  Axon guidance
rno04722  Neurotrophin signaling pathway
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05220  Chronic myeloid leukemia
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    311860 (Abl1)
   04014 Ras signaling pathway
    311860 (Abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    311860 (Abl1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    311860 (Abl1)
  09158 Development and regeneration
   04360 Axon guidance
    311860 (Abl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    311860 (Abl1)
   05206 MicroRNAs in cancer
    311860 (Abl1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    311860 (Abl1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    311860 (Abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    311860 (Abl1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     311860 (Abl1)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  ABL family
   311860 (Abl1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Kinase-like SH3_6
Other DBs
NCBI-GeneID: 311860
NCBI-ProteinID: NP_001094320
RGD: 1584969
Ensembl: ENSRNOG00000047356
UniProt: E9PT20
Position
3p12
AA seq 1143 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGMRGAAGS
TLQAPELPTKTRTCRKTAEQKDAPDALELLHTKGLGESDALDSEPAVSPLLPRKERGPPD
GSLNEDERLLPKDKKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQSERRGASEDDGREI
SNGPPALTSDAVEPTKSPKASNGAGVPNGAFREPGNSGFRSPHVWKKSSTLTSSRLAAAE
EESGLSSSKRFLRSCSASCMPHGVRDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPAL
PRKRTSESRSEQVAKSTATPPPRLVKKTEEAAEDVFKDTESSPGSSPPSLTPKLLRRQVP
ASPSSGPSHKDEATKGNASGMGTPATAEPAAPSNKAGLSKASSEEPRARRHKHSSESPGR
DKGRLSKLKPAPPPPPSSTGKAGKPAQSPSQDVAGEAGGATKTKCTSLSVDAVNSDPTKA
GQPGEGLRKSVPPSVPKPQSATKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLIS
TRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFC
VSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDI
VRR
NT seq 3432 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagtacttggggaccaaagaaggcctagtttgcccgcccta
cattttatcaaaggggcagggaagagggactcatcgagacatgggggcccacactgcaat
gtctttgtggaacatgaagccctgcagaggccagtggcctctgactttgagccccagggt
ctcagcgaagcagctcgatggaactccaaggaaaaccttcttgctgggcccagcgaaaat
gaccccaacctttttgtggcactctatgattttgtggccagtggagacaacactctcagc
atcactaaaggcgagaagctccgggtcttaggttataatcacaatggggagtggtgtgaa
gcccaaacgaaaaatggccaaggatgggtcccaagcaactacatcacccctgtcaacagc
ctggagaagcactcctggtatcacgggcccgtgtctcgaaacgctgcagagtacctgctg
agcagtgggatcaacggcagcttcttagttcgggagagcgagagcagcccgggccagagg
tccatctcgctgcggtatgaagggagggtgtaccactacaggatcaacactgcctctgat
ggcaagctctacgtctcctcggagagccgcttcaacactctggccgagttagttcaccat
cattccactgtggctgacgggctcatcaccacactgcactacccagctcccaagcgcaac
aagcccaccatctacggcgtgtcccccaactatgacaagtgggaaatggagcgcacagac
atcaccatgaagcacaagctgggcggaggccagtacggggaggtgtacgagggcgtctgg
aagaagtacagcctcactgtggccgtgaagaccctgaaggaggacaccatggaggtggag
gagttcctgaaggaagccgcagtgatgaaggagatcaagcaccctaacctggtgcagctg
ctaggggtgtgtacccgggaacctccgttctacatcatcaccgagttcatgacctatggg
aacctgctggactacctgagggaatgtaaccggcaggaggtgagcgctgtggtgctgctc
tacatggccacacagatctcatcagccatggagtacctggagaagaagaacttcatccac
agagaccttgctgcccggaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctaagcaggttgatgacaggggacacctacacagcccatgctggagccaagttc
cccatcaagtggactgcacccgagagcctggcctataacaagttctccatcaagtcggac
gtctgggcatttggagtattgctctgggaaattgctacctatggcatgtcaccttacccg
ggaattgacctgtctcaggtttatgagctgctggaaaaagactaccgcatggagcgcccg
gaaggctgcccagagaaagtctacgaactcatgcgagcatgttggcagtggaacccctct
gatcggccctcctttgctgaaatccatcaagcctttgaaaccatgttccaggagtccagc
atctcagacgaggtggagaaggagctggggaaacgaggcatgagaggagccgccgggagc
accctgcaggccccagagctgcccaccaagaccagaacctgcaggaaaaccgctgagcag
aaagatgcacctgacgccctggaactgctccacacgaagggcctgggcgaaagcgacgca
ctggacagtgaacctgctgtatcaccactgcttcctcggaaagagcgtgggcccccggac
ggcagcctaaatgaagatgagcgtctcctccccaaagacaaaaagaccaacctgttcagc
gccttgatcaagaagaagaagaaaatggcgccgacgccccctaagcgcagcagttccttc
cgagagatggatggccagtcagaacgcagaggggctagtgaggatgacggccgggaaatc
agcaatgggccaccagctctcacctcagatgcagtagagcctaccaagtccccaaaggcc
agcaatggggctggcgtccccaatggagccttccgggagccaggcaactcgggcttccgc
tctccccatgtgtggaagaagagcagcacactgaccagcagccgcctcgctgctgctgaa
gaggagagtggcctcagttccagtaagcgcttcctgcgctcctgctcggcctcctgcatg
ccccatggggttagggacactgagtggcggtcagtcacgctgcctcgggacctgccgtct
gctggtaagcagtttgactcttccacctttggagggcacaaaagtgaaaagccagctctg
cctcggaaacgcaccagtgagagcaggtctgagcaggtggccaaaagcacagcgacaccc
cctcctcggctggtgaagaagactgaggaggccgccgaagatgtcttcaaagacacggaa
tccagccctggctccagccctcccagcttgacccccaaactcctccgtaggcaggtccct
gcctccccctcctctggcccctctcacaaggacgaggccaccaagggcaatgcctcgggc
atggggactcctgccactgcagagccagcagcccccagcaacaaagcgggcctcagcaag
gcctcctccgaggagccccgtgcaaggagacacaagcacagctcggagtccccagggaga
gacaaggggcggctgtccaagctcaagccggccccgccacctccgccctcctccacaggg
aaagcagggaagcctgcacagagccccagccaagatgtggctggggaggcaggtggggcc
accaagacaaaatgcacaagtctgtctgtggatgctgtgaacagtgaccccaccaaggct
ggccagcctggagaaggactgagaaaatctgtgcccccatctgtgccaaagcctcagtca
gctactaagccaccggggacccccaccagcccggtctccaccccctccacagcgccagca
ccttcacccctggctggggaccagcagccatcttctgctgccttcatccccctcatatca
acccgtgtgtctcttcgaaagacccgacagccgccagagcgcatcgccagtggcaccatc
accaagggtgtggttctggacagtactgaggccctgtgccttgccatctcccggaactcg
gagcagatggccagccacagtgctgtgctggaggcgggcaagaacctgtacacattctgt
gtgagctacgtggactctatccagcagatgaggaacaagtttgccttccgcgaggctatc
aacaagctggagagcaacctccgagagctgcagatctgccctgcgacagcctccagtggg
ccagcggccacacaagacttcagcaagctgcttagctctgtgaaggagatcagcgacatt
gtccggaggtag

DBGET integrated database retrieval system