KEGG   Rattus norvegicus (rat): 312054
Entry
312054            CDS       T01003                                 

Gene name
Gtpbp10
Definition
(RefSeq) GTP binding protein 10
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MMR_HSR1 GTP1_OBG FeoB_N MeaB GTP_EFTU Arf SRPRB ATP_bind_1 MnmE_helical MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 312054
NCBI-ProteinID: NP_001094285
RGD: 1305878
Ensembl: ENSRNOG00000007098
UniProt: D4A3U1
Position
4q13
AA seq 369 aa
MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAHKNMTLKQLKN
KYPQKRFVAGGGANSRVSALKGSKGKDCEVPAPVGVSVTDENGEVLGELNKEKDRILVAK
GGLGGKLHTNFLPLKGQKRIIHLDLKVIADVGLVGFPNAGKSSLLSRVSHATPVIASYAF
TTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLKHLERTRQLLFVVDISGFQ
LSSVTPYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQVKLHELMKQLQKPE
DFLHLFEAKMIPEKAIEFQHIIPISAVTGEGIEELKNCIRESLDEQDDKENDAFHNKQLL
SLQRSGSAS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggtgcgctgtggttgcgcgttgttgagaaagtatggaaatttcattgataatctaaga
atcttcaccaagggaggaagtggtggaatgggctaccctcgtttaggtggagaaggtgga
agaggtggtgacgtctgggttgtggcccataaaaatatgaccttaaaacaacttaaaaac
aaataccctcagaaacggtttgtggccggaggaggagcaaacagtcgggttagtgcactg
aagggctctaagggaaaggactgtgaagtgcccgctcccgtgggtgtctcagtaactgat
gaaaacggagaagtgctaggagaactcaataaagagaaagacagaattctggttgctaaa
ggtggccttggtggtaaattacatacaaatttcctacctttgaaaggccagaagcgaata
attcaccttgacctaaaagttatagctgatgtaggcctagtaggattcccaaatgctgga
aaatcctccttactgagtcgggtttcccatgcaacacctgtgattgcaagttatgcattt
acaacactaaggcctgaacttggaaagattatgtacaatgatttcaaacagatttcagta
gctgatctcccaggtttgatagaaggagcacatatgaacaaaggaatgggccacaagttc
ctcaagcatttagagagaaccagacaactgctttttgtcgttgatatttctggatttcag
ctttcttctgtaactccatatagaactgcctttgaaactataatacttcttacaaaagag
ttggagttgtacaaagaagagctgcagacaaaacctgcactcttggcagttaataagatg
gacttgccagatgcccaagttaagcttcatgaactgatgaagcagctgcagaagccggaa
gactttctgcatttatttgaagcaaagatgattccagagaaggctatagaattccagcat
atcattcccatctcagcagttactggtgaagggattgaagagttgaagaactgtataagg
gaatcactggatgagcaggatgacaaggaaaatgatgcatttcataacaagcagctgctt
agtttgcagcgttccgggtcagcgtcttag

DBGET integrated database retrieval system