KEGG   Rattus norvegicus (rat): 312301
Entry
312301            CDS       T01003                                 

Gene name
Zfp956, RGD1304879, Zfp977
Definition
(RefSeq) zinc finger protein 956
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    312301 (Zfp956)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    312301 (Zfp956)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    312301 (Zfp956)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_6 zf-C2H2_4 zf-C2H2_jaz DUF3669 zf-LYAR C1_1 BDHCT_assoc Zn_ribbon_SprT zf_C2H2_ZHX KRAB zf-trcl
Other DBs
NCBI-GeneID: 312301
NCBI-ProteinID: NP_001014078
RGD: 1304879
Ensembl: ENSRNOG00000026874
UniProt: Q5FVJ1
Position
4q24
AA seq 447 aa
MTEAAAAPDWHMGPDLQQQAQIQCTETSLLALLAAIQAVEKKTESQGIHLQNLEVRTGSA
EKKLTDFEKTAVELSSQLEGKWAVLGTLLQEYGLLQRRLENLENQMQNRNPWVLRLPPSS
KDEAPKVSVITEEVTGCFPEQQEGSPEDWQKELCKHVAKERREVLGSLETGQLESAPSVL
PWIKQEEEVCEKSLQETTSASLCSETWLANKKRTLEGMSLAPEPSWVTEGGPGKEDFSEQ
GTCGDLLPVCREREASSLPRGSQSQSVSAAEGTENGQNFNVQELSKQLEYSHHGSQPFAS
LQCPQSAAQQVTLTRNRRAPAAQRAYTCVQCGKSFVHQSTLTTHYRTHTGEKPYKCAECE
KRFGRLSTLLEHQRTHTGERPFPCAQCGRRFGRLSTLVEHRRTHTGEKPFPCTQCDKRFT
RLANLTVHQSVHSGFLCVVSADLELAL
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgactgaggcagccgctgcaccggactggcatatggggcctgacctccaacaacaggcc
cagatccagtgcacagagacctcccttttagctctcctagctgctattcaggcagtggag
aagaaaacagagtcccagggtatccaccttcaaaatttggaagtgcggacaggatcagcc
gagaagaagctgactgactttgagaagacagctgtggagctcagcagccagctggagggc
aagtgggccgtgctggggaccctgctgcaggagtacgggctgctgcagcgacggctggag
aacctggagaaccagatgcaaaaccggaacccctgggtcctgaggcttcctcccagcagc
aaggatgaagcccccaaggtttctgtgattactgaagaggtgactgggtgtttcccagag
caacaggaaggcagcccggaagactggcaaaaggagctctgtaagcatgtggcaaaggaa
aggcgtgaggtgctgggctctctagaaacaggccagctggaatctgccccgagtgttctt
ccctggatcaagcaagaggaagaggtgtgtgagaagagcctgcaagagacaaccagtgca
tccctatgctcagaaacatggctggctaacaagaaaaggaccctggaggggatgtccctg
gcaccagagccatcctgggtgactgaagggggacctggcaaggaggatttcagcgagcag
ggtacctgtggtgatctgctccctgtttgcagagagagagaggcctcctccctccctcga
ggctctcagagtcagtcagtgtccgctgctgagggcactgagaatggccagaactttaat
gtgcaggagctcagcaagcagctcgagtactcacaccatggatcgcagccctttgccagt
ctccagtgtccccaaagtgctgcacagcaggtcactctcactaggaatcgtcgtgcaccc
gcagcccagcgtgcctacacctgtgtccagtgtggcaagagcttcgtccaccagtcgaca
cttaccacacactaccgcacacacactggggaaaagccttacaaatgtgctgagtgtgag
aagcggtttggccgcctgtctacactgctggagcatcagcgtacccacactggagagcgg
cccttcccctgcgcacagtgtggccgtcgttttgggcgcctgtccactctggtggaacat
aggcgcacacacacgggtgagaagccatttccatgtacccagtgtgacaaacgtttcaca
cgcctggccaacttgaccgtgcaccagagtgtgcactcagggtttctctgtgtagtgtca
gctgacctggaacttgctctgtag

DBGET integrated database retrieval system