KEGG   Rattus norvegicus (rat): 312678
Entry
312678            CDS       T01003                                 

Gene name
Kdm5a, Jarid1a
Definition
(RefSeq) lysine demethylase 5A
  KO
K11446  [histone H3]-trimethyl-L-lysine4 demethylase [EC:1.14.11.67]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    312678 (Kdm5a)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    312678 (Kdm5a)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     312678 (Kdm5a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     312678 (Kdm5a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    312678 (Kdm5a)
SSDB
Motif
Pfam: PLU-1 JmjC PHD ARID zf-C5HC2 JmjN
Other DBs
NCBI-GeneID: 312678
NCBI-ProteinID: NP_001264106
RGD: 1305429
Ensembl: ENSRNOG00000010591
Vega: OTTRNOG00000001225
UniProt: A0A0G2JTU9
Position
4q42
AA seq 1690 aa
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKTFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEIVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPDLDLKEKVEAEVLSTDIQPSPERGTRMNIPPKRTRRVKSQSDSGEVNRNTELKKLQ
IFGAGPKVVGLAVGAKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVAEECNKPREAFGFEQAIRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGS
GFPIKDGQRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSF
CWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMGVVM
SEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCSCPMQNKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVNRVTEALSASFNHKKDLIELRVMLEDAEDRKYPENDL
FRKLRDAVKEAETCGSVAQLLLSKKQKHRQSSDSGKTRTKLTVEELKAFVQQLVSLPCVI
SQTRQVKNLLDDVEEFHERAQEAMMDETPDSSKLQVLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAK
VCLQARPRHSMANLENIVNEAKNIPAFLPNVLSLKEALQKAREWTAKVEAIQSGSNYAYL
EQLESLSAKGRPIPVRLDALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GVYGSGKNRRKKVKEIIEKEKEKDLDLEPLSDLEEGLEETRDAAMVVAVFKEREQKEIEA
MHSLRAANLAKMTIVDRIEEVKFCICRKTASGFMLQCELCKDWFHNGCVPLPKSGSQKKG
SSWQAKDVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSA
FNRVVSSVSSSPHQAMDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIP
IKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG
AKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSVEEKPLKMKGKD
SSEKKRKRKLEKVEQFFGEGKQKTKELKKIDKPKKKKLKLNVDKSKELNKLAKKLAKEEE
RKKKKEKAAAAKVELAKESTEKKRERKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCK
DKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCAKKQGPDSPGHAPPPPFIMSYK
LPMEDLKETS
NT seq 5073 nt   +upstreamnt  +downstreamnt
atggcgggcgtgggcccggggggctacgcggcggagttcgtgccgccgcccgagtgcccg
gtctttgagcccagttgggaggagttcacagacccgctaagttttatcggtcgcatccgg
cctctggctgagaaaactggcatctgcaaaatccgtccacccaaggattggcaacctcca
tttgcttgtgaagtaaaaaccttccgattcactcccagagtccagcgcctgaatgaactt
gaggcaatgactagagtaagattggacttcttggatcaactggcaaaattttgggaactt
caaggatctacattgaagattcccgtggtggagagaaaaatcctggatttgtatgcttta
agcaagattgttgccagcaaaggaggttttgaaatagtcaccaaagagaagaaatggtct
aaagtgggtagccgtttgggatatctgccaggaaaaggaactgggtctcttttgaagtca
cactatgaaagaattctctacccatatgagcttttccaatctggtgtcagccttatgggt
gtacaaatgcctgatttagatcttaaggaaaaagttgaagctgaggttctcagtactgac
atccagccttccccagagcggggaacaagaatgaatatcccaccaaagagaacaagacga
gttaaatcccagtcagactctggagaagtaaatagaaatacagaactgaagaaacttcag
atttttggggctggacccaaagtagtaggcctggcagtaggagcaaaagataaagaagat
gaggtcacccgaagacggaaagttaccaacaggtcagatgcatttaacatgcagatgaga
caacggaaaggaactctctctgttaactttgtcgatctctatgtttgcatgttttgtggt
cgaggaaacaatgaggataaactgcttttgtgtgacgggtgtgatgacagctaccataca
ttttgtctgcttccaccacttcctgatgtgcccaaaggagactggaggtgtcctaaatgt
gttgctgaggaatgtaacaaacctcgagaagcctttggatttgagcaagctataagagaa
tatacacttcaaagcttcggagagatggcagataattttaagtctgattatttcaatatg
ccagtgcatatggttcctacagagctagtagaaaaggagttctggcggctagtaagtagt
attgaagaagacgtcattgtagagtatggagctgatatctcttcaaaagattttggaagt
ggatttcctataaaggatggtcagagaaagatgttaccagaagaggaggagtatgcactt
tctggttggaatttgaataacatgcctgttctggagcagtctgttcttgctcatattaat
gtggacatttctggtatgaaggtgccgtggctctatgtgggaatgtgcttttcttctttt
tgctggcatattgaagatcactggagttattcaattaactacttgcattggggcgagcca
aagacatggtatggtgtaccatctcatgctgcagaacaactggaggaggtgatgagggag
ctggcccctgagttatttgaatcacagcctgacctcctacatcagttagtaaccatcatg
aacccaaatgtgctcatggagcatggtgtgcctgtgtacagaactaatcagtgtgctgga
gagtttgtggtgacgtttcctcgtgcctatcactctggatttaaccagggatacaacttt
gctgaagccgtgaacttctgtactgctgactggttgcccattggacgtcagtgtgtaaat
cactatcgacggctgaggcgccattgtgtcttttcacatgaggaactcattttcaagatg
gcagcagatccagaatgcttagatgtggggctggctgccatggtatgcaaagagttgact
ctcatgactgaagaagaaacacgattgagggaatcggttgttcaaatgggtgtcgtgatg
tcagaagaagaagtcttcgaacttgttcctgatgatgagcggcagtgttcagcatgcaga
accacatgttttctctcagctctcacatgctcctgtaatccagagcgacttgtatgtttg
tatcatccaactgatttgtgctcctgccccatgcagaacaaatgtcttaggtaccgatac
ccacttgaagacctcccatctctgctttatggtgtcaaagtgagagcacagtcctatgac
acttgggtcaatcgtgtcacagaagcattatcagctagcttcaaccataagaaagatttg
attgaattgagagtaatgctggaagatgctgaggataggaaatacccagagaatgatctc
tttcgaaagctcagggatgcggtaaaagaagctgagacctgtggttctgtggctcagctg
cttctgagcaaaaaacaaaaacacaggcagagctcagatagtgggaagactcggaccaaa
ctgacagtagaagaattgaaggcctttgtccaacaacttgttagtcttccgtgtgtcatc
agccaaactcgacaagtaaagaatctgctggatgatgtagaagaatttcatgaacgtgcc
caggaggccatgatggatgaaactccagattcttccaaactccaagtgttaatagacatg
ggctctagtctctatgtggaactacctgaattgccccgactaaagcaagagctacagcag
gctcggtggctggatgaagtaagactgactctatcagacccacaacaagtcactttggat
gtcatgaagaaattgattgactctggggtaggcttggcacctcaccatgctgtggaaaag
gcaatggctgaactacaggaacttcttacagtctctgaacgatgggaagagaaggcgaag
gtctgcctgcaggcaagaccacggcacagtatggcaaatttagaaaatattgtaaatgaa
gccaagaacattccagcctttctacccaatgtgttgtccttaaaagaagccttacaaaag
gctcgtgaatggacagctaaagtggaagctattcagagcggcagcaactatgcttacttg
gaacagcttgagagcttgtctgctaaaggacgccctatccctgtgcgcctcgatgccttg
cctcaagtggagtcacaagtagcagcagcgcgagcctggagggagcggacggggcggacc
ttccttaagaagaattccagccatacattgttacaggtgctaagtccacgaacagacatt
ggtgtatatggcagtggcaaaaacagaaggaaaaaagtaaaagaaataatagaaaaagaa
aaggagaaggacctagaccttgaacctttgagtgacttagaagaaggactggaggagacg
agggacgcagccatggtggtggcagttttcaaagaacgagaacaaaaggagattgaagcc
atgcattccctcagagcagccaacctagccaagatgaccattgtggaccgcatagaagaa
gtaaagttttgtatttgccgcaagacagcgagtgggtttatgctacagtgtgagctctgc
aaagactggttccataatggctgtgttccccttcctaagtcaggttcccagaaaaaggga
tccagctggcaagccaaagacgtaaaattcctttgccctctctgcatgagatcccggagg
ccgaggctagagactattctgtcactcctggtatcccttcagaagttgcctgtacgattg
cctgaaggagaagcactgcagtgtttgacagagcgtgctatgagttggcaagatagagca
cgacaagctttagccacagatgaactgtcttctgccctggccaaactctctgtgttaagc
cagcgtatggtagaacaagcagcccgagaaaaaactgaaaagattatcagtgcagaactc
cagaaagcagccgccaatccagacttacagggacacttacctagtttccagcagtctgct
tttaaccgggtggtgagcagtgtatcctcttccccccaccaagcgatggactatgatgat
gaagaaacagactctgatgaagatattcgagagacatatggctatgacatgaaggataca
gccagtgtaaagtcctctagcagtctggaacccaatctcttttgcgatgaagagattcct
atcaaatcggaggaagtggtgacccacatgtggacagcaccttcattctgtgcagagcat
gcatattcttctgcttctaagagttgttctcaaggttctagcactccaagaaagcagcct
cggaagagccctttggttcccagaagtttggagcctccagtattagaattgtctcctgga
gcaaaagcccagttggaagaactcatgatggttggagacctcctagaagtgtctctggat
gagacacaacacatatggcggattttgcaggccacacatccaccctcagaggacagattc
ttacatatcatggaggatgatagcgtagaagagaaaccattaaaaatgaaaggaaaggat
tcttcagagaagaaacggaagcggaaattagaaaaggtagaacagttttttggagaagga
aaacagaagaccaaggagctaaagaaaatagataaacctaaaaagaagaaattaaaatta
aatgtggacaaatcaaaagagctgaataaattggctaagaagttagcaaaagaagaagag
cgaaagaaaaagaaagaaaaggctgctgcagccaaagtggagcttgcgaaagagagcacc
gagaagaaaagagagagaaaggtgctggatatcccttcaaagtatgactggtcgggcgca
gaggagtctgatgatgagaatgctgtatgtgcagcacagaactgccaaaggccgtgtaag
gacaaggtagactgggtacaatgtgatggtggctgtgatgagtggtttcatcaagtttgt
gttggtgtatccccagaaatggctgaaaatgaagattacatctgtataaactgtgcaaag
aagcaggggccagatagcccaggccacgcaccacctcctcccttcataatgagctacaaa
ctaccaatggaggatcttaaagagaccagttag

DBGET integrated database retrieval system