KEGG   Rattus norvegicus (rat): 312679
Entry
312679            CDS       T01003                                 

Gene name
Il17ra
Definition
(RefSeq) interleukin-17 receptor A
  KO
K05164  interleukin 17 receptor A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    312679 (Il17ra)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    312679 (Il17ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    312679 (Il17ra)
   04090 CD molecules [BR:rno04090]
    312679 (Il17ra)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL17 receptor family
   312679 (Il17ra)
CD molecules [BR:rno04090]
 Proteins
  312679 (Il17ra)
SSDB
Motif
Pfam: IL17R_fnIII_D1 IL17R_fnIII_D2 SEFIR
Other DBs
NCBI-GeneID: 312679
NCBI-ProteinID: NP_001101353
RGD: 1306559
Ensembl: ENSRNOG00000011153
UniProt: D4A740
Position
4
AA seq 868 aa
MATPRRWPRVVPGPALGWLLLLLSALFRGRASLRLLDFPALVCSQEGLNCRVENSTCLDD
SWIYPRNLTPSSPKNIYLHLNVSSTQHGDLVPVLHVEWTLQTDASILYLEGAELSILKLN
TNEQLCVKFKFLSKLSNHHKRWRFSFSHFVVDPGQEYEVTVHHLPKPIPDGDPNHKSKTI
LVPGCEDTEMKMTTPCVSSGSLWNPNITVETLDTQHLRVDFTLWNESTPYQILLESFSGS
ENQSCFEDIKQISAPGQEEFHQRSNVTFTLSKSGWCCHHLVQVQPFFNSCQNDCLRHAVT
VPCPVISETPVSITAADYIPLWVYGLITLIAILLVGSVILLIICMTWRLSGADQEKHGDD
SKVNGILPTTDLTPPPLQPRKVWIVYSADHPLYVDVVLKFAQFLITACGTEVALDLLEEQ
TISEMGVMTWVSRQKQEMEESGSKIIVLCSRGTRAKWKAILGWAEPAVQLRCDHWKPAGD
LFTAAMNMILPDFKRPACFGTYIVCYFSGICNERDVPDLFNITSRYPLMDKFEEVYFRIQ
DLEMFEPGRMHHVKELTGENYLQSPSGRQLKEAVVRFQEWQTRYPDWFERENLCLAGDQD
LPSLDEEVFEDPLLPPGGRIVKQQPLVRELPSEGCLVVDVCAREEESGVVKLEPQLWPQR
QLMAQTLQTLVLPTEQVPAAHVVEPVRLLDGTGAATQLAIAEDGEACPLLGVRRNSILCL
PMDSDDSPLCSTPMMSPDHLQGDAREQLESLMLSVLQHSLSAQAQEGWPRPEVVLKDCMP
SEEEQRQSVQSDQGYISRSSPQPPDWLTEEEELELGESGESLSPEELRSLRSVQRRLFFW
ELEKNPGWDSRGQEQKISLPPGPPNPAT
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcgactccgcgccgctggccacgggtcgtccccgggcccgcgctgggatggctgctt
ctgctgttgagcgcgctgttccggggccgcgcctccctgcgcctcctcgacttcccggct
ctagtctgctcgcaggaggggctgaactgcagagtcgagaatagtacttgcctggatgac
agctggatttaccctcgaaacctgacgccgtcttccccgaaaaacatctatctccatctg
aacgtttcgtctacccagcacggagacctagtccctgtgttgcacgttgagtggaccttg
cagacagatgccagcatcctgtatctcgagggtgcagagctgtccatcctgaagctgaac
accaatgagcagctgtgtgtcaagttcaagtttctgtccaagctgtcgaatcatcataag
cggtggcggttctccttcagtcacttcgtggtagatcctggccaggagtatgaggtgact
gttcaccacctgcccaagcccatccctgacggggacccaaaccacaagtccaagaccatc
ttagtgcctggctgcgaggacacggagatgaagatgactacaccgtgtgtgagctcaggc
agcctttggaaccccaacatcacagtggagaccttggacacccagcatcttcgagtggac
ttcaccctgtggaatgaatccaccccctaccagatcctgctggaaagtttttcgggctca
gagaaccagagctgctttgaagacattaaacagatatctgcgcccggacaggaggaattc
caccagcgatccaatgtcacattcactctgagcaagtctggctggtgctgccaccacctc
gtgcaggtccagcccttcttcaacagctgccaaaatgactgcttgagacacgctgtgact
gtgccctgcccagtcatctcagagaccccagtttccataacagccgcagactatattccc
ctctgggtgtatggcctcatcaccctcatcgccatcctgctggtgggctctgtcatcctg
ctgattatctgcatgacctggaggctttctggtgctgatcaagagaaacatggagatgac
tccaaagtcaatggcatcttgccaacaacagacctgactcccccacccctgcagcccagg
aaggtctggatcgtctactcggctgaccaccccctctatgtggacgtggtcctaaagttc
gcccagttcctgatcactgcctgtggtactgaagtagcccttgacctgctggaagagcag
accatctctgagatgggggtcatgacttgggtgagccggcagaagcaggaaatggaggag
agcggttccaagatcatcgtcctgtgctcccgagggacccgagctaagtggaaagccatc
ttgggttgggcggagcctgctgtccagctacggtgtgaccactggaagcctgctggggac
cttttcacagcagccatgaacatgattctaccagacttcaagaggccagcctgcttcggc
acctacattgtttgctacttcagtggcatctgtaacgagagggatgtccccgacctcttc
aacatcacctccaggtacccacttatggacaaatttgaggaggtttacttccggatccag
gacctggagatgtttgaacctggccggatgcaccatgtcaaagagctcacaggggaaaat
tacctgcagagccctagtggccggcagctcaaggaggctgtggttaggttccaggagtgg
caaacccggtaccccgactggtttgagcgagagaacctctgcttagcaggtgaccaagac
cttccatccctggatgaggaagtgtttgaagacccactgctgccaccagggggaagaatc
gtcaaacagcagcccctggtgcgggagctgccttcagaaggctgccttgtggtagatgtc
tgtgccagggaggaagaaagtggagtggtaaagctggagcctcagctgtggccacaaaga
cagctaatggctcagaccctccaaaccttggtgctgccaacagaacaggtccctgcagct
catgtggtggagcctgtccgtcttctagatggcactggagcagctacccagctggccatt
gccgaggacggcgaggcttgcccgctgcttggggtccggaggaacagcatcctttgcctc
cccatggactcagatgactcgcctctctgtagcactccaatgatgtcacctgaccacctc
caaggcgatgcaagagagcagctagaaagcctgatgctctcggtgctgcagcatagcctg
agcgcacaggctcaggagggctggccgaggcctgaggtggtcctcaaggactgcatgccc
tctgaggaggagcagcggcagtcagtgcagtcagaccagggctacatctccagaagctcc
ccgcaaccccccgactggctcacagaggaggaagagctagaactgggtgagtccggtgag
tctctctctccggaggagctgcggagcctgaggagtgtccagcggcggcttttcttctgg
gagcttgagaagaaccctggctgggacagcagaggccaggagcagaagatcagcctcccc
cctgggcctcctaatcctgctacttaa

DBGET integrated database retrieval system