KEGG   Rattus norvegicus (rat): 313050Help
Entry
313050            CDS       T01003                                 

Gene name
Lck, Lck1, Lcktkr
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04380  Osteoclast differentiation
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05166  Human T-cell leukemia virus 1 infection
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    313050 (Lck)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    313050 (Lck)
   04660 T cell receptor signaling pathway
    313050 (Lck)
   04658 Th1 and Th2 cell differentiation
    313050 (Lck)
   04659 Th17 cell differentiation
    313050 (Lck)
  09158 Development
   04380 Osteoclast differentiation
    313050 (Lck)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    313050 (Lck)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    313050 (Lck)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    313050 (Lck)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    313050 (Lck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     313050 (Lck)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   313050 (Lck)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    313050 (Lck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 313050
NCBI-ProteinID: NP_001094179
RGD: 2994
Ensembl: ENSRNOG00000009705
UniProt: Q01621
Position
5q36
AA seq 509 aa AA seqDB search
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKSTLPIRTGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLEKGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccccgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagagtacgctgcccatccggacc
ggctctgaagttcgggacccactggtcacctatgagggctccctcccaccagcctccccg
ctgcaagacaacctagttattgccctgcacagctatgagccctcccatgatggagacttg
ggctttgaaaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgaccactggccaagaaggcttcatccccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaaaaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcaccgcc
ggatccttttcactgtcagtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggactacacgatctggtccgccattacaccaacgcctctgatgggctgtgcacaaaattg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagagagacattgaagttggttgagcggctgggagctggccagttcggggaagtgtgg
atgggatactacaatggacacacgaaggtggcagtgaaaagtctgaagcaagggagtatg
tctcctgatgccttcctggcagaggctaacctcatgaagcagctgcagcacccgcggctc
gtccggctttatgcagtggtcacccaggagcccatctacattatcacagaatacatggag
aacgggagcctagtagatttcctcaagactccctcgggcatcaagttgaacgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagagcagaattac
atccatcgtgacctgcgggctgccaacatcctggtgtctgacacgctgagctgcaaaatt
gcagactttggcctggcacgtctgattgaggacaatgaatacacggcccgggagggggcc
aagtttcccattaagtggacagcaccagaagccattaactatgggacctttaccatcaag
tcagatgtgtggtccttcgggatcctgctgacagagatcgtcacccatggccggatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggaaaaaggctaccgaatggtg
cgacctgacaactgcccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggacaggcccacgtttgactaccttcggagcgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system