KEGG   Rattus norvegicus (rat): 313536
Entry
313536            CDS       T01003                                 

Gene name
B4galt2
Definition
(RefSeq) beta-1,4-galactosyltransferase 2
  KO
K07967  beta-1,4-galactosyltransferase 2 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00052  Galactose metabolism
rno00510  N-Glycan biosynthesis
rno00513  Various types of N-glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno00515  Mannose type O-glycan biosynthesis
rno00533  Glycosaminoglycan biosynthesis - keratan sulfate
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Module
rno_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    313536 (B4galt2)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    313536 (B4galt2)
   00513 Various types of N-glycan biosynthesis
    313536 (B4galt2)
   00515 Mannose type O-glycan biosynthesis
    313536 (B4galt2)
   00514 Other types of O-glycan biosynthesis
    313536 (B4galt2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    313536 (B4galt2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    313536 (B4galt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    313536 (B4galt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     313536 (B4galt2)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     313536 (B4galt2)
    2.4.1.90  N-acetyllactosamine synthase
     313536 (B4galt2)
    2.4.1.-  
     313536 (B4galt2)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   313536 (B4galt2)
SSDB
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Other DBs
NCBI-GeneID: 313536
NCBI-ProteinID: NP_001101435
RGD: 1305358
Ensembl: ENSRNOG00000019609
UniProt: D4A2A5
Position
5
AA seq 369 aa
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSTRSPAHALYPAASS
STNCSRPNTTAASSGLPEVPSARPGPTAPVIPPCPDVPPGLVGRVVIEFTSPMPLERVQR
ENPGVLLGGRYSPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGVYVINQ
HGEETFNRAKLLNVGFLEALKEDATYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDK
FGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRI
GRYRMIKHDRDKHNEPNPQRFNKIQNTKMSMKWDGIGSVRYRVLEVSRQPLFTNITVDIG
QPMSWLTQG
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgagcagactgctggggggtacgctggagcgggtctgtaaggctgtgctccttctctgc
ctgctgcacttccttgtggctgtcatcctctactttgacgtctacgcccagcacctggcc
tttttcagccgcttcagtacccgaagcccagcccatgccctctaccctgcagccagcagc
agtaccaactgctctcggcccaacaccactgctgccagctccgggctccctgaagtgccc
agtgccaggcctggccccacagctccagtcattccaccctgtcctgatgtgccgcctggt
cttgtgggccgagtggtcatcgaattcacctcacccatgcctctggaacgggtgcagagg
gagaacccaggcgtgctcctgggcggccgctattctccacctgactgcaccccagcccaa
acggtggcagtcatcatcccctttagacaccgggagcaccacctacgctattggctccac
tatctgcaccccatgttgaggcgacagcggctgcgctacggtgtctatgtcatcaaccag
catggcgaggagaccttcaaccgagccaagctgctcaacgtgggcttcctagaggcactg
aaagaggatgccacctatgactgcttcatcttcagtgatgtggacctggtccctatggat
gaccgcaatctgtaccgttgtggtgaccagccccgccacttcgccattgccatggacaag
tttggcttccggttgccctatgccagctactttggaggtgtgtcaggcctgagcaaggcc
cagtttctgaggattaatggttttcccaacgagtactggggctggggcggcgaggacgat
gacatcttcaaccggatctccctgactgggatgaagatctcacgcccagacgtccggata
ggccgctaccgcatgatcaagcacgaccgggacaaacataacgagcccaaccctcagagg
tttaataagattcaaaacacaaagatgagcatgaagtgggacggcattggatccgtgcgg
taccgcgtcttggaagtatctcggcaaccactcttcaccaacatcacagtggacattggg
cagcccatgtcatggctcactcaaggctga

DBGET integrated database retrieval system