KEGG   Rattus norvegicus (rat): 313772Help
Entry
313772            CDS       T01003                                 

Gene name
Acap3, Centb5
Definition
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    313772 (Acap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    313772 (Acap3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    313772 (Acap3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    313772 (Acap3)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    313772 (Acap3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   313772 (Acap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap PH Ank_5 Ank_2 Ank_3 Ank_4 Ank PH_11 DUF5434 PH_8
Motif
Other DBs
NCBI-GeneID: 313772
NCBI-ProteinID: NP_001101469
RGD: 1310711
Ensembl: ENSRNOG00000022307
UniProt: D4A346
Position
5q36
AA seq 563 aa AA seqDB search
MEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDALTVVVDDLRLCSVKPCEDIERRF
CFEVVSPTKSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSID
STTDSRERGVKGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGV
HCSKVRSLTLDSWEPELLKLMCELGNNTMNQIYEAQCEGPGIRKPTASSSRQDKEAWIKD
KYVEKKFLRKLTSAPVREPPRRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAG
TMERKFRRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSGLGGSSDGSSDVLAFGTGSV
VDSVTEEEGAESEESSSEVDGEAEAWSLADVRELHPGLLAHQAARTRDLPALAAALAHGA
EVNWADTADEGKTPLVQAVLGGSLIVCEFLLQNGADVNQRDSLGRAPLHHATLLGRTGQV
CLFLKRGADQHALDQEQQDPLTIAVQAANADIVTLLRLARMAEEMREAEAPPGQPGPLPG
SSPTELQYRRCIQEFIGLHLEES
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggagggctatctctttaagagagccagcaatgccttcaagacctggaaccgacgatgg
ttctccattcagaacagccagctggtctaccagaaaaaactcaaggatgcactgactgtg
gtggtagatgacctacgcctatgctctgtgaagccatgtgaggacatcgaacggaggttc
tgctttgaagttgtgtcacctaccaagagctgtatgctgcaggctgactcggagaagctg
cgacaggcttgggttcaagctgtgcaggctagcattgcctctgcctaccgggagagtcca
gatagctgctacagtgagaggctggaccgcacagcatcaccatcaacaagcagcattgat
tccaccacggactctcgggagcgtggagtcaagggcgagagcgtgctgcagcgagtgcag
agtgtggctggtaacagccagtgtggcgactgtggccagccagatccccgctgggccagc
atcaacctgggtgtgctgctctgtattgagtgctcaggcatccacaggagcttgggtgtc
cactgctctaaggtacgatcgcttacactggattcctgggagccagagctgctaaagctg
atgtgtgagcttggaaataacaccatgaaccagatctatgaggcccagtgtgagggccca
ggcattagaaaacccacagccagtagttccaggcaggacaaagaggcgtggatcaaggac
aaatacgttgaaaagaagttcctccggaagttgacttctgcaccagtccgggaaccccca
agacgctggagggcacagaagtgccagcgccctcacagctccccccacgcccccaccacc
cgccgcaaggtccggcttgagcccgtcttgccctccgtcgctgctttgtcctcagctggc
actatggagcgcaagttccgccgagactccctcttctgccctgatgagctggactccctc
ttctcctattttgatgcaggggctgctggggctggtccacgcagtctaagcagcgacagt
ggtctaggaggtagctctgatggcagttcggatgttcttgccttcgggacaggctctgtg
gtggacagtgtcaccgaggaagagggtgctgagtccgaggagtccagcagtgaggtagat
ggagaagcggaggcctggagcttggcagatgtacgtgagctgcatcccgggctactggca
catcaagcagcacgtacccgtgatctgccggcactggctgcagcactggcccatggagct
gaagtcaactgggctgacacggcagatgagggcaagacaccactggtgcaggctgtacta
gggggttccttgattgtctgtgagttcctcctgcaaaatggagctgatgtgaaccaaaga
gacagccttggccgggcaccattgcaccatgctacactcttgggccgtactggccaggtc
tgtctattcctgaagcggggggctgaccagcatgccctggaccaggagcagcaggaccca
ctgaccatcgcagttcaagcagcgaatgctgacattgtcacactgcttcgcctggcccgc
atggctgaggagatgagagaagctgaggcaccccctggtcagccaggccccctgccaggc
agcagtcctaccgagctgcagtaccgcaggtgcatccaggagttcattggcctccacctg
gaggaaagctag

DBGET integrated database retrieval system