KEGG   Rattus norvegicus (rat): 313774
Entry
313774            CDS       T01003                                 

Gene name
Fam132a, C1qdc2, RGD1307059
Definition
(RefSeq) family with sequence similarity 132, member A
  KO
K21410  adipolin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    313774 (Fam132a)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 C1q domain-containing proteins
  CBLN / gliacolin group proteins
   313774 (Fam132a)
SSDB
Motif
Pfam: TNF Collagen C1q
Other DBs
NCBI-GeneID: 313774
NCBI-ProteinID: NP_001101470
RGD: 1307059
Ensembl: ENSRNOG00000019864
UniProt: D3ZQD2
Position
5q36
AA seq 308 aa
MWAWGWAAAALLWLQTAGVRARQELKKPRQLVVRVDSPNITTSSHEGFPGSIKPPEASGP
ELSDAHMTWLNFVRRPDDGASRKRCRGRDKKSRGLSGLPGPPGPPGPPGPPGSPGLEVTP
EALLQEFQEMLKEAAELRFSGIPDSLLPQEPRQRLVVEAFHCRLKGPVTVDKKTLVELQG
FQAPTTQGAFLRGSGLSLSLGRFTAPVSAIFQFSASLHVDHSELQGRGRLRTRDTVRVLI
CIESLCHRHTSLEAVSGLESNSRVFTVQVQGLLYLQSGQYVSVFVDNSSGAVLTIQNGSS
FSGMLLGT
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtgggcttggggctgggctgcggcagctctcctctggctacagactgcaggagtccgg
gcacgacaggaactcaagaagcctcggcagctggttgtgcgtgtggattctcccaatatt
accacatccagccatgagggattcccaggctccatcaagccgccggaagcctctggacct
gagctctcagatgcccacatgacatggctgaactttgtccgacggccggatgatggggcc
tctagaaaacggtgccgtggccgggacaagaagtcgcgaggcctctcaggtctcccagga
cccccaggaccccctggccctcctggtccacctggttcccctggtttggaagttacccca
gaggccttgctgcaggaatttcaggagatgctgaaagaggccgcagaacttcgattctca
gggataccggactcgctgttaccccaggaacccaggcagcggttggtggtcgaggccttc
cattgccgtttgaaaggccctgtgacggtagacaagaagactctggtggaactgcaagga
ttccaggctcctactacccagggtgccttcctgcggggatctggcctgagcctgtccttg
ggccgatttacagcgccagtctctgccatcttccagttttctgccagcctgcacgtggac
cacagtgaactgcagggcagaggccggttacgtacccgggacacggtccgtgtcctcatc
tgtattgagtccttgtgtcaccgtcatacgtccctggaggctgtgtcaggcctggagagc
aacagcagggtcttcaccgtgcaggttcaggggctgctgtatttacagtctggacagtat
gtctctgtgttcgtggacaacagttctggggcagtcctcaccatccagaacggctccagc
ttctccgggatgcttttgggtacgtag

DBGET integrated database retrieval system