KEGG   Rattus norvegicus (rat): 314131Help
Entry
314131            CDS       T01003                                 

Gene name
Insm2
Definition
(RefSeq) INSM transcriptional repressor 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz zf-BED zf_UBZ zf-Di19 zf-H2C2_2 zf_C2H2_ZHX
Motif
Other DBs
NCBI-GeneID: 314131
NCBI-ProteinID: XP_006225831
RGD: 1306949
Ensembl: ENSRNOG00000007754
UniProt: D3ZKF8
Position
6q23
AA seq 495 aa AA seqDB search
MPRGFLVKRTKRSGSFYRTRPAEPLFPPPGPLAAPPSPEEPDPGLLGSPCLAPPQDSTEW
GAGGGDGPGPSPARPAGPELRRAFLERCLRSPVSAESFPSATAFCSAAPAAATSGEQLVP
PRVPVSVPVPVPVSVPAPHGLQRRGKGAPGCPSAPAAVRKPKAVRRLSFADEVTTSPVLG
LKIKEEEPGAPARALGGVRTPLGEFICQLCKQQYADPFALAQHRCSRIVRVEYRCPECDK
VFSCPANLASHRRWHKPRPTPACTASKPPHAPLTPPDPSLAAGKENGCLPRTEDQHPQAR
DSSGDGQHRDSAALPGLQALVHPEAARPQAPYSEVILGRHGPRPSGASTGATSEVFVCPY
CHKKFRRQAYLRKHLGTHETGSARATTPGFGSERTAPLTFACPLCGAHFPSADIREKHRL
WHAVREELLLPALVGAPTEAGPGGASEGSAQQIFSCKYCPSTFFSSPGLTRHINKCHPSE
SRQVLLLQMPLRPGC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggggattcctcgtgaagcgaactaaacgctcgggcagcttctaccgcacgcgc
ccggccgaaccgcttttcccacctccgggtcccctcgcggcgccaccctcgccggaggag
cccgatccagggctgttggggtccccctgcctcgcacctccgcaggacagcaccgagtgg
ggcgcgggaggcggcgacggcccgggacccagccccgcgaggccggcgggccccgagctg
cgccgcgcgttcctggagcgctgcctgcgctcgccggtctccgcggagtcctttcccagc
gccaccgccttctgctccgcggcgcccgcggccgcgacctcgggcgaacagttggtgcca
ccacgggtccctgtatccgtcccagtccccgtccccgtctccgttcccgccccgcatggc
ctccagcgccgcggtaagggtgccccaggctgcccctcagcgcccgcagccgtcaggaaa
cctaaggctgtgaggcggctgagcttcgcagatgaggtgacaacgtccccggtgctgggt
ctgaagatcaaagaggaggagcccggggcgccagcacgggctctgggcggcgtccgcaca
ccgctgggggagttcatctgccagctgtgcaagcagcagtacgcggaccccttcgcgctg
gctcagcaccgctgctcccgcatcgtgcgcgtcgagtaccgctgtcccgagtgcgacaag
gtcttcagctgtcctgcgaacctcgcctcccaccgccgctggcacaagccacgtcccacg
cccgcctgcaccgcgagtaaacctccccacgcgccgctgacccctccggacccttccctg
gcggctggcaaggagaacggctgcctgccgcgaaccgaagatcagcaccctcaggctcgg
gacagctccggggacggtcagcaccgggacagcgccgcgctcccgggcctacaggctcta
gtgcacccggaggccgcgcgaccccaggctccctactccgaggtgattctagggcgccac
gggcccaggccgagcggtgccagcacaggagcgacatcggaggtcttcgtgtgcccgtat
tgtcacaaaaagttccgtcgccaagcctatctgcgcaagcacctaggcacccatgagacc
ggctcggcccgtgcaacaaccccgggttttggctcggagcgcacggccccactcaccttt
gcgtgcccgctttgcggggcgcacttcccgtctgcggatatccgagagaagcaccggcta
tggcacgctgtccgagaggagctgctactgcccgccttggtcggggcacctacggaagcg
ggccccggaggagcatccgagggtagcgctcagcagattttctcctgcaagtactgcccc
tccactttttttagctcccccggcttgacccggcacatcaataagtgccacccctcagaa
agtcggcaagtgctgctgctgcagatgccactgaggcctggctgttga

DBGET integrated database retrieval system