KEGG   Rattus norvegicus (rat): 314164
Entry
314164            CDS       T01003                                 

Gene name
Lrfn5
Definition
(RefSeq) leucine rich repeat and fibronectin type III domain containing 5
  KO
K16358  leucine-rich repeat and fibronectin type-III domain-containing protein 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    314164 (Lrfn5)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   314164 (Lrfn5)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 I-set Ig_3 ig LRR_9 Ig_2 fn3 DUF240 LSR
Other DBs
NCBI-GeneID: 314164
NCBI-ProteinID: NP_001101494
RGD: 1309357
Ensembl: ENSRNOG00000005550
UniProt: D4A1J9
Position
6q23
AA seq 719 aa
MEKFLFYLFLIGIAVRAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPALLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQTMDLHIIKLPHLLNSTNNIHEPDPGSSDISTSTKSGSNASSSNGDTKMSQDK
IVVAEASSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLASGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQMQGCSVTLPQSMSKQAMGHEENA
QCCKVASDSAIQSSETCSSQDSSTTTSALPPTWTSSAPVSQKQKRKTGTKPSAEPQSEAV
TNVESQNTNRNNSTALQLASCPPDSVTEGPTSQRAHTKPNALLTNVDQNVQETQRLESI
NT seq 2160 nt   +upstreamnt  +downstreamnt
atggaaaaatttcttttttacctgtttctcattggcatagctgtgcgagctcagatctgt
ccaaagcgttgtgtctgtcagattttgtctcccaatcttgcaaccctttgtgccaagaaa
gggcttctgtttgttccaccaaacattgacagaagaactgtggaactacggctggcagac
aattttgttacaaatatcaaaaggaaagattttgccaatatgaccagcttggtggacctg
actctatccaggaatacaataagttttattacaccccatgcttttgctgatctacgaaat
ttgagagcattgcatttgaatagcaacagattgactaaaattacaaatgatatgttcagt
gggctttccaatctccaccatttgatattgaacaacaatcagctgactttaatttcttcc
acagcattcgacgatgtttttgcccttgaggagctggacctgtcctataataatctagaa
acgattccatgggatgcggtagagaagatggtgagcttgcacactcttagtttggatcac
aacatgattgacaacattcctaagggaactttctcccacttgcacaagatgactcggcta
gatgtaacatcaaataaactgcaaaagctgcctcctgaccctctctttcagcgagcacag
gtgctggccacctcaggaatcataagcccatcgacatttgcattgagttttggtgggaac
cccttgcattgcaattgtgagttactgtggctgaggcgactgtcaagagaagatgacctg
gagacctgtgcttctcctgcccttttaactggtcgttatttttggtcaattcctgaggaa
gagtttttatgtgagcctccactcattactcgtcatacacacgagatgagagtcttggag
ggtcaaagggcaacactgaggtgcaaagctagaggagaccctgagcctgccattcattgg
atttctcctgaagggaagctgatttcaaatgcaacaagatcactggtgtatgataatgga
actcttgacatccttataacgactgtaaaagatacaggagcatttacctgtattgcttcc
aatcctgcaggggaagcaacgcaaaccatggatcttcacataattaaactcccacaccta
ctaaacagcaccaacaatatccatgagcctgatcctggttcctcagatatctctacgtcc
acaaagtcaggttcgaatgctagcagtagtaacggtgatacaaagatgagtcaagataaa
attgtggtggcagaagcatcttcgtcaacagcattacttaaatttaattttcaaagaaat
attcccggaattcgtatgtttcaaatccagtacaatggtacttatgatgacacccttgtt
tacagaatgatacctcctacgagcaaaacatttctggtcaataatctggcttctggaact
atgtatgacttgtgtgtcttggccatatatgacgatggcatcacttccctcactgccaca
agagtcgtgggttgcatccagtttactacggaacaggattatgtccgttgccactttatg
cagtcccagtttttgggtggcaccatgattattatcattggtggaatcattgttgcatcc
gtgttggttttcatcatcatactaatgatccggtataaggtttgtaacaataatgggcaa
cacaaggtcaccaaggttagcaacgtttattctcagactaacggggctcagatgcaagga
tgcagtgtcacgctgccccagtccatgagcaagcaagccatgggccatgaagagaatgcc
cagtgctgtaaagttgccagtgacagtgcgattcagtcttcagaaacatgttcgagtcag
gactcttctactactacctctgctttgcctcctacctggacttcaagtgcgcctgtgtct
caaaagcagaaaagaaagactggcacgaagccaagtgctgagccgcagagtgaagctgtc
acaaatgttgagtctcaaaacactaacaggaacaactcaactgccttgcagttagctagc
tgccctcctgattctgttacagaggggcccacatctcaaagagcacataccaagccaaat
gctttgctgactaatgttgaccagaatgtccaggaaacacagaggctggagtccatataa

DBGET integrated database retrieval system