KEGG   Rattus norvegicus (rat): 314300
Entry
314300            CDS       T01003                                 

Gene name
RGD1307704, No66
Definition
(RefSeq) similar to RIKEN cDNA 2410016O06
  KO
K16914  bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 [EC:1.14.11.- 1.14.11.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    314300 (RGD1307704)
   03036 Chromosome and associated proteins [BR:rno03036]
    314300 (RGD1307704)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     314300 (RGD1307704)
    1.14.11.-  
     314300 (RGD1307704)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    314300 (RGD1307704)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    314300 (RGD1307704)
SSDB
Motif
Pfam: Cupin_4 Cupin_8 Cupin_1 Cupin_2
Other DBs
NCBI-GeneID: 314300
NCBI-ProteinID: NP_001101510
RGD: 1307704
Ensembl: ENSRNOG00000010126
UniProt: D3ZU57
Position
6q24
AA seq 597 aa
MDELPNGNGAAPLKRGRGRRRRQPQPRGASVLALPLRPRKVRRHRKSAASRVAALRARAL
LSEDSDSNVESVRGKRERPAELPEASRSAEPRPVPVRPRPASATLPRRVEGRAALSRNLG
KPAPLPGSHVDDPERPWDSPLQQVLAELNGIPSSRRRAARLFEWLLAPLPPDHFYRRLWE
REAVLVRRQDHSYYEGLFSTSDLDWMLRYEDVHFGQHLDAARYIDGRRETLNPPGRALPA
AAWSLYQAGCSLRLLCPQAFSPTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDI
EAFVLQLEGRKLWRVYRPRDPSEELALTSSPNFSQEDLGEPVLQTVLEPGDLLYFPRGFI
HQAECQDGVHSLHLTLSTYQRNTWGDFLEAVLPLAMQAAIEENVEFRRGLPRDFMDYMGA
QHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVH
GLPIRWEAGEPVNVGAQLTTETQVHMLQDGIARLVGEGGRLFLYYTVENSRVYHLEEPKC
LEIYPQQADAMELLLRSYPEFVRVGDLPCDSVEDQLSLATMLYDKGLLLTKTPLVLS
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggatgagcttccgaatggcaacggcgcggcgccgctgaagcgtggacgcgggaggcgc
cggcgccagccgcagccccgcggcgcgtcggtcttggccctgcccttacggccacggaag
gtccgaaggcaccggaaaagtgcggcgtcccgcgtggccgcgctgagagctcgcgcgctc
ctgagcgaagactcggactcgaacgtggaatcggtccggggcaagcgggagaggcctgca
gagctaccggaggcctcgcggtcggccgaaccgcggccggtgccagtgcgtccgagaccg
gcttcggcgactctgccgcgccgcgtggaggggcgggccgcgctctcccgaaacctgggg
aagcccgctccgttgccgggctcgcacgtggatgacccggaacggccctgggattcgccg
ctgcagcaggtgttggcggagctgaacggcatccccagcagccggaggcgcgccgcccgc
ctcttcgagtggctcctggcgcccctgcctccggaccacttctaccggcggctgtgggag
cgggaggcggtgctggtgcggcggcaggaccacagctactacgaaggtctattctctacc
tccgacctggactggatgctgcgctacgaggacgtgcacttcgggcagcacctggatgct
gcgcgctacatcgatgggcggcgggaaaccttgaacccaccgggccgggcacttcccgct
gccgcgtggtccttgtaccaagccggctgctccttacgccttctttgcccgcaagctttc
tcgcccacggtgtggcagtttttggctgtgcttcaggaacagtttggaagcatggcaggc
tccaacgtttacctcacgccccccaactcgcagggcttcgctccccactacgacgacatc
gaggctttcgtgttacagctggaaggtcggaaactctggcgagtctaccgaccgcgggac
cccagtgaagagttggcactgacatctagtcccaacttcagccaggaggaccttggtgag
ccggtactccaaacggtactggaacccggagacctgctctattttcctcggggcttcatt
catcaagctgaatgtcaggatggagtccattctctgcacctcaccttgtctacctaccag
cgcaacacctggggcgacttcctggaggctgttctgcctctggcaatgcaggcagcaata
gaggaaaatgtggaatttcgcaggggtctgcctcgagacttcatggattatatgggggcc
cagcattcagactctaaggatcccagaaggacagctttcatggaaaaagtgcgggtcttg
gttgctcgcctgggacactttgctcctgtcgatgctgtggctgaccagagagcaaaagac
ttcattcacgattccctgccccctgtgttgacggatagggaaagggctctaagtgtgcac
gggctcccgattcgctgggaggctggagaacctgtaaatgtgggggcccagctgacaaca
gaaacccaagtccatatgcttcaggatggcatagctcggctggtgggtgaggggggccgc
ttgttcctgtattacacagtggaaaactctcgagtgtatcatctggaggaacccaagtgc
ttagaaatctacccccagcaagccgatgccatggaactcttgctgcgctcctacccagag
tttgtgagagtaggggatttgccctgtgacagtgtggaagaccagctttccttggcgacc
atgttatatgataaggggctgctgctcactaaaacgcccctagttctgagttag

DBGET integrated database retrieval system