KEGG   Rattus norvegicus (rat): 314423
Entry
314423            CDS       T01003                                 

Gene name
Bcl11b, Ctip2
Definition
(RefSeq) B-cell CLL/lymphoma 11B
  KO
K22046  B-cell lymphoma/leukemia 11B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    314423 (Bcl11b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    314423 (Bcl11b)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    314423 (Bcl11b)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-H2C2_5 DUF3268 zf-C2H2_7
Other DBs
NCBI-GeneID: 314423
NCBI-ProteinID: NP_001264216
RGD: 1311128
Ensembl: ENSRNOG00000005776
UniProt: H9N1L4
Position
6q32
AA seq 880 aa
MSRRKQGNPQHLSQRELITPEADHVEAAILEEDEGLEIEEPSSLGLMVGGPDPDLLTCGQ
CQMNFPLGDILVFIEHKKKQCGGLGSCYDKVLDKGSPPPSSRSELRRVSEPVEIGIQVTP
DEDDHLLSPTKGICPKQENIAGPCRPAQLPSMAPIAASSSHPPTSVITSPLRALGVLPPC
FPLPCCGARPISGDGTQGEGQMEAPFGCQCKDEPSSYICTTCKQPFNSAWFLLQHAQNTH
GFRIYLEPGPASTSLTPRLTIPPPLGPEAVAQSPLMNFLGDSNPFNLLRMTGPILRDHPG
FGEGRLPGTPPLFSPPPRHHLDPHRLSAEEMGLVAQHPSAFDRVMRLNPMAIDSPAMDFS
RRLRELAGNSSTPPPVSPGRGNPMHRLLNPFQPSPKSPFLSTPPLPPMPTGTPPPQPPAK
SKSCEFCGKTFKFQSNLIVHRRSHTGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLA
GRSDDGLSAASSPEPGTSELPGDLKAADGDFRHHESDPSLGPEPEDDEDEEEEEEELLLE
NESRPESSFSMDSELGRGRENGGGVPPGVAGAGAAAAALADEKALALGKVMEDAGLGALP
QYGEKRGAFLKRAGDAGDTGAGGCGDAGAPGAVNGRGGAFAPGAEPFPALFPRKPAPLPS
PGLGGPALHAAKRIKVEKDLELPPAALIPSENVYSQWLVGYAASRHFMKDPFLGFTDARQ
SPFATSSEHSSENGSLRFSTPPGDLLDGGLSGRSGTASGGSTPHLGGPGPGRPSSKEGRR
SDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQIGKEVY
RCDICQMPFSVYSTLEKHMKKWHGEHLLTNDVKIEQAERS
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgtcccgccgcaaacagggcaacccgcagcacttgtcccagagggaactcatcacgcca
gaggctgaccatgtggaggctgctatcctcgaggaagatgagggtctggagatagaagag
cctagcagcctggggctgatggtgggcggccccgaccctgacctactcacctgtggccag
tgtcagatgaacttcccgctgggggacatcctggtttttatagagcacaagaagaaacag
tgtgggggcctgggctcctgctacgacaaggtactggacaagggaagccctccgccttcc
tctcgctctgagctcaggagagtgtctgaaccagtggagatcgggatccaggtcaccccc
gatgaagatgaccatctactgtcacccacgaaaggcatctgtcccaagcaggagaacatt
gcagggccgtgcaggcctgcccagctgccatcgatggcccccatagctgcctcctcttcc
caccctcccacctccgtgattacttcacctctgcgtgccctgggcgttctcccaccctgt
ttcccgctgccttgctgtggtgcacgccccatctcgggcgacgggactcagggtgagggt
cagatggaggctccctttggatgccagtgtaaagatgagccttccagctacatttgcaca
acatgtaagcagcccttcaacagcgcctggttcctgctgcaacatgcgcagaacacgcat
ggcttccgcatctacctggagcccgggcccgccagcacctcgctcacgcccaggctcacc
atcccgccgccgctcgggccggaggccgtggcgcagtccccactcatgaatttcctcggg
gacagcaatcctttcaacctgctgcgcatgacgggccccatcctgcgggaccaccccggc
ttcggagagggccgcctgcccggtacgccaccgctcttcagcccaccgccacgccatcac
ttggacccacaccgcctcagtgcagaggagatggggctcgtggcccagcaccccagtgcc
ttcgaccgagtcatgcgcctgaaccccatggccatagactctcccgccatggacttctct
cggcggctgcgagaactggccggtaacagctccacaccgccgcccgtgtccccaggccgt
ggcaaccctatgcaccggctgctgaacccttttcagcccagccccaagtccccgttcctc
agcacgccaccgctgccacccatgcccacgggcacgccgccaccgcagccgcctgccaag
agcaagtcctgtgagttctgcggcaagaccttcaaattccagagcaatctcatcgtgcac
cggcgcagccacacgggcgagaagccctacaagtgccagctgtgcgaccacgcgtgctcg
caggcgagcaagctcaagcgccacatgaagacgcacatgcacaaggcgggctcgctggct
ggccgctcagacgatgggctctcggccgccagctccccagagcccggcaccagcgagctg
ccaggtgacctcaaagcggccgatggcgacttccgccaccatgagagcgacccatctctg
ggacccgagcctgaggacgacgaggacgaggaggaggaagaagaagagctgctgctggag
aatgaaagccgacctgagtcgagcttcagcatggactcggagctgggccgtggccgcgag
aatgggggtggtgtgccaccaggggtggcgggcgcgggggctgcagctgcggctctggca
gatgagaaggcgctggcattgggcaaggtgatggaggacgcagggctgggcgcactgccg
cagtatggggagaagcgaggcgccttcctgaagcgtgcaggcgacgcgggtgacaccgga
gctggtggctgcggggatgcaggtgcaccgggcgcagtgaacgggcgtggcggggccttc
gcgccaggcgcagagcccttcccagcgctcttcccacgcaagcccgcaccgctgcccagc
ccggggcttggtggtcctgcgctacacgcggccaagcgcatcaaggtggagaaggacctg
gagctgccacccgccgccctcatcccatccgagaacgtgtactcgcagtggctcgtgggc
tacgcggcgtcgcgccacttcatgaaggacccgttcctgggcttcacggatgcgcgccag
tcgcctttcgccacgtcgtcggaacattcctctgagaacggcagcctgcgcttctccacg
ccacccggggacctgctggacggcgggctgtcggggcgcagtggcacggcgagcgggggc
agcacgcctcacctgggtggcccgggtcctgggcggccgagctccaaggagggccgccgc
agcgacacgtgcgagtactgcggcaaggtcttcaaaaactgtagcaacctgacggtgcac
cggaggagccacaccggcgagcggccttacaagtgcgagctgtgcaactacgcgtgcgcg
cagagcagcaagcttacgcgccacatgaagacgcacggtcagatcggcaaggaggtgtac
cgctgcgatatctgccagatgcccttcagtgtctacagtaccctggagaaacacatgaaa
aagtggcacggtgaacacttgctgactaatgatgtcaaaatcgagcaggctgagaggagc
taa

DBGET integrated database retrieval system