KEGG   Rattus norvegicus (rat): 314473Help
Entry
314473            CDS       T01003                                 

Gene name
Kif26a
Definition
(RefSeq) kinesin family member 26A
  KO
K10404  kinesin family member 26
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    314473 (Kif26a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     314473 (Kif26a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 314473
NCBI-ProteinID: NP_001163819
RGD: 1307957
Ensembl: ENSRNOG00000013661
UniProt: D3ZUT0
Position
6q32
AA seq 1873 aa AA seqDB search
MVGRGASLCAVQPAVAECRSARESPPLEVSPRKRLPAGLDQDLCSSRPAPEGAGASAEQG
HSTGGGGWCRHCHTKLVELKRQAWKLVSGPGTPLRDPCLSTLLLDKLPASGVQPSCRPDT
ESRCDVCTTHLHQLTREALRLLQTPASHEDPDASRGGLGAPSPRDPPGPVGLMGRQPPVG
PDRRKAAAWPSGPSVQVSVAPAGLGGALSTVTIQAQQCLEGVWSLSRVNSFLPPTCLAEA
AVAAVAVADTVRDCPPTAGSDRMSKAWGRGTACTTALVTPAPGTSAGGSTAPSAAASFFI
RAAQKLSLASKRKKHPPPPAPSARGSSTYATDFSGTLQLWPPPVPPCLLRAASKAKENPS
NFGKVKVMLRIWPAQGVQRSAESTSFLKVDSRKKQVTLYDPAAGPPGCAGLRHAPTAPVP
KMFAFDAIFPQDSEQAEVCSGTVADVLQSVVGGADGCIFSFGHMSLGKSYTMIGKDSSPQ
SLGIVPCAISWLFRLIDERKERLGTRFSIRVSAVEVCGHDQSLRDLLAEVASGCLQDTQS
PGVYLREDPVCGTQLRNQNELRAPTAEKAAFYLDAALAARSTSRAGCGEDARRTSHMLFT
LHVYQYRVEKCGQGGMSGGRSRLHLIDLGSCEAAPSRGGEASGGPLCLSLSALGSVILAL
VNGAKHVPYRDHTLTMLLRESLATTSCCTTMIAHISDSPTHHAETLSTVQLAARIHRLRR
KKGKHASSSSGGESSCEEGRARRPPHLRPFHPRTVVLDPDRSAPALSGDPDYSSSSEQSC
DTVIYVGPGGTALSDRELTDNEGPPDFVPIIPALSRRRPSEGPRDADHFRCSTFAELQER
LECIDGSEGFPGPQGGSDGAQASPSRGSRKPSLPESTCLRKAVAPSVVTGCPRSSSGQET
PRSTSEPSKTGPQGDQRVDGTRPEPPAPDKITGGGGRRLLPSPAPPPPRQPEARGVPTEP
GGEGADSGPRTPPVGMSGQAPLPALLSDSAYPSARGRHLDRGLLTTTVTLQQPVELNGED
ELVFTLVEELPLGGLAGATRPSSLASMSSDCSLQALASGSRPVSIISSINDEFDAYTSQV
SEGPGDAGELPEGTVWPGGSPASSIGSWLSDVGVCLPESRGTTPQPPFNPDSAAGPGPPE
FLTPGSSLEDSKVRSSECGRPDNPGSSARSPHPGEAVSITQTQPGREPWARSPHEAASAQ
TIHSSLPRKPRTTSTVSRARPSRGPYSPGGLFEDPWLLRAEDCDTRHIASTGRAPSPTPG
SPRLPETQIVLACAQRVVDGCEVASRMSRRPEAVARIPPLRRGATTLGVTTPTASCGDAP
AEATAHSGSLKATSSSKKSVSPKGAFFPRPSGAGPPAPPVRKSSLEQSTALTPTQALGLT
RTGATSAFRGEEEARPTGRSDSSVPKATSSLKARAGKMEVPHRPSGHMSLERCEGLTHGS
SKVRDVAGRPPRAVPRLGVPPASPPLGPGPACRSSPAKGIGATKPPAGGAKSRNLGPSTS
RALGAPVKPLAPVVGKTTGGAVPGPRTAPRSVPGIGAKAGRGTIMGTKQAFRAAHSRVHE
LAASGSPGRGGLTWGSTDSDSGNDSGVNLAEERQPSSPALPSPYSKVTAPRRPQRYSSGH
GSDNSSVLSGELPPAMGRTALFYHSGGSSGYESMIRDSEATGSASSAPDSMSESGAASPG
ARSRSLKSPKKRATGLQRRRLIPAPLPDAAALGRKPSLPGQWVDLPPPLAGSLKEPFEIK
VYEIDDVERLQRHRLPLRENEAKGPVCISSKLRLAERRQQRLQEVQAKRDHLCEELAETQ
GRLMVEPGRWLEQFEVDPELEPESAEYLVALEQATAALEQCVNLCKAHVMMVTCFDIGVA
ATAAVPGPQEVDV
NT seq 5622 nt NT seq  +upstreamnt  +downstreamnt
atggttggccgcggcgcctccttgtgtgcggtgcagcccgcggtggctgagtgccgatcg
gctcgagagtccccgccgcttgaggtatctccgcgcaagaggctgcccgccgggctcgac
caagacctatgcagcagccgccctgctccggagggcgcgggagccagcgcagagcagggc
cactcgaccggtgggggcgggtggtgccgccactgccacacgaagctcgtggagctcaaa
cgacaggcgtggaagttggtcagcgggcccgggactcctctacgggatccttgcctctct
accctgctgcttgacaagctcccggcctctggggttcagccatcatgccgccctgacact
gagagccgctgtgacgtgtgcaccacgcatctacaccagctcacccgggaagccctgcgc
ctgttacagaccccggccagccacgaggaccctgatgcttcccgaggaggccttggagct
cccagccctagggacccacctggaccagtgggcctcatggggaggcagccccctgtggga
cctgacaggagaaaggcagcagcttggccatctggccccagcgtccaggtgtccgtggcc
ccagcaggccttgggggagcactgagtacagtcaccatacaagcccagcagtgcctggag
ggcgtgtggagcctctcaagggtcaacagcttcttaccaccaacttgcctggccgaggct
gctgtagctgctgtggctgtggccgacactgtccgagactgtcccccaacagcaggctcc
gatcgcatgtctaaggcgtggggccgagggacagcatgcacgacagccctggttacccca
gccccaggcacttcagcagggggttccacagctccatcggcagcagcctctttctttata
agggctgcccagaagctcagcctggcctctaagcgcaagaagcacccgccaccgcctgca
ccctctgctcgaggttcatccacttacgccacggacttcagtggcactctgcagctgtgg
ccgcccccggtgcccccctgcctgctcagggccgcctccaaggccaaggaaaaccccagc
aactttggaaaggtgaaggttatgctgcgaatatggccagcacaaggagtccagcgctca
gccgagtccacgtccttcctgaaggtggattctcgaaagaagcaggtgaccctctatgac
cctgctgctgggcctccgggctgtgcgggcctccggcacgcccccacggcgccagtcccc
aagatgtttgcttttgacgccatcttcccccaggactcggagcaggctgaggtctgctcg
gggacagtggctgacgtgctccagtctgtggttggtggagctgatggctgcattttttcc
ttcggccacatgagcctcggcaagtcatataccatgattgggaaggacagctcaccccag
agcctgggcatcgtgccctgtgctatctcctggctcttcaggctcattgatgaacgcaag
gaaaggctgggcacacgcttctccatccgtgtgtctgccgtggaagtgtgtggccatgac
cagagtctgcgggacctgcttgctgaggtggcttccggctgccttcaggacacccagtct
ccgggcgtgtaccttcgggaggaccctgtgtgtgggacacagctccggaaccagaacgag
ctgcgtgcacccactgcagagaaggcagccttctacctggacgcagccctggcagcccgc
agcactagccgtgctggctgcggggaagacgcccggcgcacctcccacatgctcttcacc
ctgcatgtgtaccagtaccgtgtggagaagtgtggccaaggaggaatgtctggaggtcgt
agccgcctgcacctcatcgacctgggcagctgtgaggcagcccctagcagaggaggagaa
gcttcaggaggacccctgtgtctgtctctgtcagctctgggcagcgtcatcctggccctg
gtcaatggggccaagcatgtaccctacagggaccacacactcaccatgttactgcgggag
tcgctggctaccaccagctgctgtaccaccatgattgcccacatctcagactctccaacc
caccatgcagagacacttagcaccgtgcagctggccgcccgtatccaccgcctgcgcagg
aagaagggcaagcatgcatccagctcctccggaggggagagttcctgtgaggagggccgg
gcccgccgtccaccacaccttcggcccttccacccacgcaccgtggtgttggaccctgac
cgctcagctcctgccctgtctggggaccctgattactcatccagcagtgagcagtcttgt
gacacggtcatctacgtgggtcccggtgggacagcactgtcagaccgtgagctcactgac
aacgagggcccacctgattttgtgcccattatcccagccctgagtcgacgcaggccctcc
gagggaccccgggacgctgaccacttccgctgtagtacttttgcagagctgcaggagcgc
ctggagtgtatagatggcagtgagggattccctggtccccagggcggctctgacggagcc
caagccagcccctctcggggcagcaggaaaccctccttacctgagtccacgtgcctcagg
aaggctgtggccccctcagtggttaccggttgccctcgaagcagctctgggcaagaaact
ccccggagcacctcagagccctctaagactggcccacagggtgaccagagagtggacggt
acccggcccgagccacctgccccagacaagatcacaggaggcggaggcaggaggctgcta
cccagtccagcccctccaccgcctcggcagccggaagctcgaggcgtccccacagaaccc
gggggagagggtgctgatagcgggccgcggacacccccagtgggcatgagtgggcaggca
cccctgcccgcactgctctcagactcagcttatccctctgctcgtggacgccatctggac
aggggtctgctgaccaccaccgtgaccctgcagcagccggtggagctgaacggcgaggat
gagctggtgttcacactggtggaggagctgccactgggcggacttgcgggggccacgcgg
ccctccagcctggccagcatgagcagtgactgttccctgcaggccttggcctcaggctcc
aggccagtcagtatcatcagtagtatcaatgacgagttcgatgcctatacctcgcaggtg
tctgagggccccggggacgctggggagctcccagagggaacagtgtggcccggtggcagt
ccagcctcgtccattggctcctggctgagcgatgttggcgtctgcctgcctgaaagccgt
ggtaccaccccgcagcctcccttcaaccctgactctgcagcagggccgggtccgccagag
tttcttaccccaggcagctccctagaggacagcaaggtcaggtcctcagagtgtgggaga
ccagacaatcccggctcctcggcccggagtccccaccctggggaggcggtttcgataact
cagacccaacctggcagagagccttgggccaggtccccgcatgaggcagcctcagcccag
actatccactccagccttccccggaaacccaggactacctccacagtcagccgagctcgt
cccagccggggtccatacagccctggagggctgtttgaagacccttggctactccgggcg
gaggactgtgacacacgccatatagcctccacaggcagggcccctagcccaaccccaggc
tctcctcgattacctgagactcagatcgtgctggcttgtgcccagagagtggtggatggg
tgcgaggtggcatccagaatgtcccggagaccagaggctgtggctcggatcccacctttg
aggaggggagccaccacgctgggagtgaccacacccacagcatcctgtggggacgctcca
gcagaggcaacggcccattcgggaagcctgaaggccacctccagcagcaagaagagcgta
tctcccaagggggccttctttccaaggcctagcggggcaggccccccagctccaccggtg
cgaaagtctagcttggagcagagcacagccctcacccctacccaggccctgggactgacc
aggacaggagcaacttctgccttccgaggggaggaggaagccaggcccactggtcgctct
gactcctctgtccccaaggccacatccagcctgaaagcccgagccggcaaaatggaggtg
ccacaccgtccctctggccacatgtccctagaacggtgtgagggcctgacacacggcagc
agcaaagtcagagatgttgcaggacggccaccaagggctgtgcccaggttgggcgtaccc
cccgccagccctccacttggaccaggtcctgcctgtaggagcagcccagccaagggcatt
ggagcaaccaagcctccggctggtggagctaagagtcgtaatctggggcctagtacctct
cgggctctgggtgctccggtaaagccactggcacctgtggtaggcaagacaactggtggg
gctgtgccaggacccagaactgctccacggtctgtgcccggtattggggctaaggcaggc
cggggtaccatcatgggcactaagcaggcattccgggctgcccatagccgtgtccacgaa
ttggcagccagtggatctcctggtagaggtggcctcacctggggctcgactgactcggac
agtggcaatgacagtggtgtaaacctggctgaggagcggcagccctcgagccccgcccta
ccctccccctatagcaaagtgactgcaccgaggagaccccagcgctacagcagtggccac
ggcagtgacaacagcagtgtgctgagtggggagctcccccctgccatgggccgtactgca
ctcttctaccacagcggtggcagcagtggctacgagagcatgatccgggacagcgaggcc
actggcagtgcctcctcagccccagactccatgagcgagagcggagcagcctccccgggt
gcccgttcccgcagcctcaagtccccaaagaaaagagccacaggtctacagcggaggagg
ctgattccagcgccacttcctgatgctgctgccttaggccgaaagcccagcctccctggg
caatgggtggacttgcccccgcccctggccggctctctgaaggagcctttcgagatcaag
gtgtatgagatagatgacgtggagcgtctgcagcggcaccggctgcctctgagggaaaat
gaagccaagggcccagtgtgcatcagctccaagctgcgtctagcagagcgcaggcagcag
cggctgcaggaagtgcaggccaaacgtgaccacctctgcgaggagctggctgaaacccag
ggccggttgatggtggaacctgggcgctggctggagcagttcgaggtggacccagagttg
gagcccgaatcggctgagtatctggtggccctggagcaagccacagctgccttggagcag
tgtgttaacctgtgcaaggcccatgtcatgatggtcacctgctttgacatcggagttgct
gccaccgctgctgtaccagggccacaagaggtggacgtttga

DBGET integrated database retrieval system