KEGG   Rattus norvegicus (rat): 314640
Entry
314640            CDS       T01003                                 

Gene name
Tjp3
Definition
(RefSeq) tight junction protein 3
  KO
K06097  tight junction protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    314640 (Tjp3)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 SH3_2 Guanylate_kin Tricorn_PDZ
Other DBs
NCBI-GeneID: 314640
NCBI-ProteinID: NP_001101543
RGD: 1309247
Ensembl: ENSRNOG00000020501
UniProt: D3Z8G7
Position
7q11
AA seq 907 aa
MAVADMEELTIWEQHTATLYKDPRRGFGIAVSGGHDRAGGPVVVSDVVPGGPAEGRLQTG
DHIVMVNGVSVENVTSAFAIQILKTCTKTANITVKRPRRVQLPATKASPASGHQLSDQEE
ADHGRGYEGDSSSGSGRSWGERSRRSRAGRRVRMGSHGRRSSCGGSEANGLDLVSGYKRL
PKQDVLMRPLKSVLVKRRNSEEFGVKLGSQIFIKHITESGLAARNRGLQEGDLILQINGV
SSANLSLSDTRRLIEKSEGQLTLLVLRDSGQFLVNIPPAVSDSDSSLMEDISDLTSELSQ
APPSHIPPPPLKSRRSPEDSQTDSPVETPQPQRRERSVDSRAIAEPESPGESRYDIYRVP
SRQSLEDRGYSPDTRVVRFPKGVSIGLRLAGGNDVGIFVSGVQAGSPADGQGIQEGDEIL
QVNDMPFRNLTREEAVQFLLGLPAGEDVELVIQSKQDIFRKMVQSRVGDSFYIRTHFELE
PSPPYGLGFTRGDVFHVVDTLYRGSGSGHGHSSHGGLWLAARMGRDLREQERGVIPNQSR
AEQLASLEAAQRAAGLGPGASTGSNPRAEFWRLRGLRRGAKKTMTQRSREDLSALTRQGH
YPPYERVVLREASFKRPVVILGPVADIAMKRLTTEVPEQFEIAESVSRTDSPSKIIKLDT
VRVIAERDKHALLDVTPSAIERLNYVQYYPVVIFCAPESRSALKALREWLAPASRRSSRR
LYAQAQKLQKHSGHLFTATIPLNGTSDSWYQEVKAVIQQQQARPIWTAEDQLNGSSEDLD
LPGHGLAASSGDLSCDSRANSDYEDTDGEGTYTDREGEPQDFDEEAPPTALARSSEPVWV
DDHQGLMGHGRIAAAEVQADSHYTPDQRRQDSMRTYKHEALRKKFTRARDIESSDEEGYD
WGPATDL
NT seq 2724 nt   +upstreamnt  +downstreamnt
atggcggtggcagacatggaagagttgaccatctgggaacagcacacagccacactgtac
aaggacccccgccgaggctttggcatagctgtgtctggaggtcatgaccgagctggtgga
cctgtggtcgtgtctgatgtggtacctggaggccccgctgagggcaggcttcagactggg
gaccacatcgtcatggtgaatggtgtctctgtggagaatgtcacatctgcttttgccatc
cagatccttaagacctgcaccaaaacagccaacattacagtgaagcgtccccgaagggtc
caactgcctgccaccaaggctagcccagcttctggccaccagctctcagaccaggaggaa
gctgaccatggccggggctatgagggggactcctccagtggctcaggtcgatcttggggt
gagcgttctcgccggtccagggctggtcgccgcgtcaggatgggcagccatgggcgccgg
agctcttgtggaggttctgaggccaatggtctggacctggtatctggctacaagcgcttg
cctaagcaggatgtgctaatgagaccgctaaagtccgtgctggtgaaacgaagaaacagc
gaagagtttggagtgaagctaggcagtcagatcttcataaaacacatcacagagtccggc
ctcgctgctcggaaccgtgggctgcaggagggagaccttatcttacagatcaacggagtg
tccagtgctaatctatccctgagtgacacacggaggctcattgagaagtcagaggggcag
ctaaccctgctggtgctgagggacagtgggcagttcctggtgaacatccctccagcagtg
agtgacagcgacagctccctaatggaagacatctcagacctgacctcggaattgtcccag
gcgcccccttcccacattccaccgccacctctgaagagtcggcggagccctgaggacagc
cagacggattccccagtggagaccccacagccccagaggcgggaacggtcggtggattca
agagccatcgctgaaccagagtctcctggagaaagccgctatgacatttaccgggtccct
agtcggcagagcctggaggaccgtggctacagccccgacacccgtgtcgtgcgcttcccc
aagggtgtgagcattggtctgcggctggccggcggcaacgacgtgggcatcttcgtgtcc
ggggtgcaggcaggcagccccgccgacgggcaaggcatccaggaaggggatgagatcttg
caggtgaatgatatgccatttcggaacctgactcgggaggaggctgtgcagtttctgtta
gggctgcctgcaggggaagacgtggagctggtgatacagagcaagcaggacatcttcagg
aagatggtccagtcccgcgtgggtgactccttctacatccgcacacactttgagctggag
ccaagcccgccctacggcctgggcttcactcgcggtgatgtgttccacgtggtggacacg
ttgtaccggggctctgggtcaggccacgggcacagcagccatgggggtctctggctggcg
gcccgaatgggcagagatctccgagagcaagaacgaggcgtcattcccaaccagagcagg
gccgagcagctggccagtttggaggccgcgcagcgggccgcgggcctggggccaggcgcc
tcaacaggctccaacccacgggccgagttctggcgactccgaggtctccggcgaggggcc
aagaagacaatgacccagcggagccgcgaggacctgtcggcgctgaccaggcagggacac
tacccaccctacgagcgagtcgtgctacgagaagccagttttaagcgccccgtggtgatc
ctaggacccgtggcagacattgctatgaagagactgacaacagaggtgccagagcagttt
gagattgcagaaagcgtgtcccggactgacagcccatccaagatcatcaaattggacaca
gtgcgggtgatcgcagagagggacaagcacgcactcctggatgtcaccccctctgccatc
gagcgcctcaactacgtgcagtactaccctgtcgtcatcttctgtgctccggagagccgg
tcagcgctcaaggcccttcgcgagtggctggcccccgcctctcgccgcagcagccgccgc
ctgtatgcgcaggcccagaagctgcagaaacacagtggccacctcttcaccgccaccatt
cccctgaatggcactagtgactcctggtaccaggaagtcaaggctgtcatacagcaacag
caggcgcgaccgatctggactgcggaggaccagctgaatggctcatccgaggaccttgac
ctgccgggccatgggctggccgccagctctggagacctcagctgtgacagtcgggctaac
agcgactacgaagacaccgatggggagggcacctatacggatagagagggcgaaccccag
gatttcgatgaggaagccccacccacggccctggcccggtcctcagagcctgtgtgggta
gatgaccaccaggggctgatgggtcatgggaggatcgcagccgcggaggtgcaggccgac
agccactacaccccggaccagcggcgccaagacagcatgcggacctacaagcatgaggcc
ctgagaaagaagttcacaagagcccgggacatcgaatcctctgacgaagaaggctatgac
tggggcccagccaccgacctgtga

DBGET integrated database retrieval system