KEGG   Rattus norvegicus (rat): 314642
Entry
314642            CDS       T01003                                 

Gene name
Fzr1
Definition
(RefSeq) fizzy-related protein homolog
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04120  Ubiquitin mediated proteolysis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    314642 (Fzr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    314642 (Fzr1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    314642 (Fzr1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    314642 (Fzr1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     314642 (Fzr1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Nup160 Ge1_WD40
Other DBs
NCBI-GeneID: 314642
NCBI-ProteinID: NP_001101544
RGD: 1308713
Ensembl: ENSRNOG00000004169
UniProt: B1WCA1
Position
7
AA seq 493 aa
MDQDYERRLLRQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN
FHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPS
TPEHKGLFTYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLD
APELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSER
GNLVAVGTHKGFVQIWDAAAGKKLSVLEGHTARVGALAWNADQLSSGSRDRMILQRDIRT
PALQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKA
IAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTK
ESVSVLNLFTRIR
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggaccaggactatgagcgacggctcctgcgacagatcatcatccaaaatgagaacacc
gtgccgtgtgtctcagagatgcggagaaccctgacaccagccaactccccagtgtcctct
cccagcaagcatggtgaccgcttcatcccctcgcgggccggggccaactggagcgtaaac
ttccataggatcaatgaaaatgagaagtcccccagccagaaccgcaaagccaaggatgcc
acctcagacaacggcaaagatggccttgcttactccgcactgctgaagaatgagctgctg
ggtgccggcatcgagaaggtgcaggacccacagacagaggatcggcggctgcagccatcc
accccagagcacaagggtctctttacgtattccctcagcagcaagcgctcgagtccagat
gatggcaacgacgtgtccccatattctctatccccagttagcaacaaaagtcagaagctg
ctgcggtcgcctcggaagcccacgcgcaagatttccaagattcccttcaaggtgctggac
gcgccagagcttcaggacgacttctacctcaacctggtggactggtcctccctcaatgtg
ctcagcgtggggctaggcacctgcgtgtacctgtggagcgcatgcaccagccaggtgacc
cggctctgtgacctctccgtagaaggggactcagtgacttccgtgggctggtctgagcgg
gggaacctggtggcagtcggcacacataagggcttcgtgcagatctgggatgctgccgct
ggcaagaagctatctgtgctggagggacacacagcgcgcgtgggggcgctggcctggaat
gctgaccagctgtcatccggtagccgggaccgcatgatcctgcaacgggacatccgcaca
ccagcactgcagtcagagcggcggctgcaaggccatcgacaggaagtatgcggcctgaag
tggtccacagaccaccagctgctcgcctcggggggcaatgacaacaagctgctcgtgtgg
aaccactcaagtctaagccctgtgcagcagtacacggagcacctggcagccgtgaaggct
attgcctggtcaccacaccagcatggactgctggcctctggtggtggcactgccgaccgc
tgcatccggttctggaacactctgacaggccagcctctgcagtgcattgacacaggctca
caagtgtgcaacctggcctggtccaagcatgccaacgagctggtgagcacacatggctac
tcacagaaccagatcctcgtgtggaagtacccgtcccttacacaggtggccaagctcact
ggccactcgtatcgtgtcctctacctggccatgtcccctgacggggaggccatcgtcact
ggagctggagatgagacccttcggttctggaacgtcttcagcaagacacgctctacaaag
gaatccgtgtctgtgctcaacctctttacccggatccgatag

DBGET integrated database retrieval system