KEGG   Rattus norvegicus (rat): 314906
Entry
314906            CDS       T01003                                 

Gene name
Kif5a
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04728  Dopaminergic synapse
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    314906 (Kif5a)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    314906 (Kif5a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    314906 (Kif5a)
   05012 Parkinson disease
    314906 (Kif5a)
   05016 Huntington disease
    314906 (Kif5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    314906 (Kif5a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    314906 (Kif5a)
   04147 Exosome [BR:rno04147]
    314906 (Kif5a)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    314906 (Kif5a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     314906 (Kif5a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   314906 (Kif5a)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF3584
Other DBs
NCBI-GeneID: 314906
NCBI-ProteinID: NP_997688
RGD: 1303035
Ensembl: ENSRNOG00000005299
UniProt: Q6QLM7
Position
7q22
AA seq 1027 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVRGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENIETEQKLSGKLYLADLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDSALAAEICEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KEEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESEPQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQTVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDAEEVKKALELQMENHREAHHRQLARLRDE
INEKQKTIDELKDLDQKLQLELEKLQADYERLKNEENEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TEVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNNLFQNYQNLHLQ
AAPSSTSDVYFASNGATSVAPLASYQKANTDNGNATDINDNRSDLPCGYEAEDPAKLFPL
HQETAAS
NT seq 3084 nt   +upstreamnt  +downstreamnt
atggcggagaccaataacgaatgcagcatcaaggtgctttgccgatttcggcccctgaac
caggccgagatcctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
attattgggggaaagccatatgtcttcgaccgtgtattccccccaaacacgactcaggag
caggtttaccacgcctgtgccatgcagatcgtcaaagacgtccttgctggctacaacggc
acaatttttgcttatggacagacatcctcagggaaaacgcacaccatggagggaaagctg
cacgaccctcagctcatgggcatcattccccggatcgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacattaaggtgtcttactttgagatttacctg
gataagatccgtgaccttttggatgtgaccaagacaaacctgtctgtgcatgaggacaaa
aaccgggtgccgtttgtcaggggttgtaccgaacgctttgtgtccagcccagaggagatt
ctggatgtgattgatgaggggaagtcgaaccgtcacgttgccgtcaccaacatgaatgag
cacagctctcggagtcacagcatcttcctcatcaacatcaagcaggagaacatagagacg
gagcagaagctcagcgggaaactgtaccttgcggatctggccggaagcgagaaggtcagc
aagacaggagcagagggagccgttctggatgaggcaaagaatatcaataagtcgctgtcg
gccctggggaatgtgatctctgctctggccgagggcactaaaagctacgtgccgtaccgt
gacagcaaaatgacgaggattctccaggactctctgggagggaactgcaggaccaccatg
ttcatctgctgctcaccatccagctacaatgacgcagagaccaagtccacactcatgttt
gggcagcgggcaaagaccatcaagaacactgcctcagtgaatctggagttgactgctgag
caatggaagaagaaatatgagaaggagaaggagaagaccaaggcccagaaggagacaatt
gcgaagctggaggctgagcttagccggtggcgcaatggagagaatgtgcctgagactgag
cgcctggctggagaggactcagctctggcagccgagatctgtgaggagacccctgtgaat
gacaactcatccatcgtggtacgcatcgcaccggaggaaaggcagaaatacgaggaagag
atccgccgtctctacaagcagctcgacgacaaggatgatgagatcaaccagcagagccaa
ctcattgagaagctgaagcagcagatgctggaccaggaagagctgctagtgtccactcgg
ggagacaatgagaaggtccagcgggagctgagccacctgcagtctgagaacgatgccgcg
aaggaggaggtgaaggaagtgttgcaggccctggaggagctggcagtcaactatgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggatgagctgtcc
cagaaagtggccaccatgctgtccctggagtctgagccacagcggctccaggaagtcagt
ggacaccagcgaaaacggatcgctgaggtgctgaatggactgatgaaggacctgagtgag
ttcagtgtcatcgtgggcaacggcgagattaagctgcctgtggagatcagtggggccatc
gaagaggagttcacggtggcccgactctacatcagcaagatcaagtcagaggtgaagtcc
gtggttaagcgatgccggcagctggagaacctccaagtggagtgtcatcgcaagatggag
gtgaccggtagggagctgtcgtcttgccagctgctcatctcacagcacgaggccaagatc
cgttcgctcacggaatacatgcagactgtggagttgaagaagcggcacctggaagagtcc
tatgactccctgagcgatgagctagccaagctccaggcgcaggaaactgtacacgaggta
gctctgaaagacaaggagccagatacgcaggatgcggaggaggtgaagaaggccctggaa
ctacagatggagaatcatcgtgaggcccatcaccggcagctggcccgcctccgagatgag
atcaatgagaaacagaagaccattgatgagcttaaagacctggaccagaagctccagtta
gagctggagaagcttcaggctgattacgagagactgaagaacgaagagaacgagaagagt
gccaagctccaggagctgacatttctgtatgagcggcatgagcagtccaagcaggacctc
aaggggctggaggagacagttgcccgtgaactccagaccctccacaacctgcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcattcccaaaagcagaagatctcctttcttgagaacaacctggaacagctt
acagaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttcgggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgctatgaaggacaagcgccgataccagcaggaggtggaccgcatc
aaggaagctgtgcggtacaagagctctggcaagcggggccactctgcccagattgctaag
cctgtgaggcccggccactatcctgcctcctcacccaccaacccctacggtacccggagt
cccgagtgtatcagctacaccaacaacctcttccagaactaccagaacctgcacctgcag
gctgcgcctagctccacctcagacgtgtactttgccagcaacggagccacatctgttgcc
cccttggcttcctaccagaaggccaacacggacaatggaaacgccacagatatcaacgac
aacaggagtgacctgccctgcggctatgaggctgaggacccagccaagcttttccctctc
caccaagagacggcagccagctaa

DBGET integrated database retrieval system