KEGG   Rattus norvegicus (rat): 315434Help
Entry
315434            CDS       T01003                                 

Gene name
Ankrd49, RGD1311759
Definition
(RefSeq) ankyrin repeat domain 49
  KO
K21439  ankyrin repeat domain-containing protein 49
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    315434 (Ankrd49)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 Sulfotransfer_4
Motif
Other DBs
NCBI-GeneID: 315434
NCBI-ProteinID: NP_001119755
RGD: 1311759
Ensembl: ENSRNOG00000009233
UniProt: B1WC29
Position
8q12
AA seq 239 aa AA seqDB search
MEEEKVKDDENPDLESSVDFSEQFNQLELLETHGHLIPTGTQSLWAGNSDDDDEQEEKNE
EWYQLQEKKLEKEPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGH
LDVVRELVAQGADVHAVTIDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL
AAGNRDSRDTLELLLMNRYIKPELKNNSRETASDIARRTSIYHYLFEIAEGCTNTSPPP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaaaaagtaaaggacgatgaaaacccagacctggaaagctctgtggacttt
tctgaacagtttaaccagcttgaattgttggaaacccacggacacctgattcccactggt
acgcagagtctctgggcaggcaattctgatgatgatgatgagcaagaggaaaaaaacgaa
gagtggtatcaattgcaagaaaaaaagctggagaaagagccaagcaaattgcttctttgg
gctgctgaaaagaatcggcttgctacagtgcagagactcctctctgagaaggccgctgag
gtgaacaccagagacgaagatgaatatacccctcttcaccgcgcagcctacagcggacat
ttagatgttgttcgggagctggtggctcagggggcagatgttcatgcagtgaccatagat
ggctggacaccgctgcacagtgcttgtaagtggaataacaccagggtggcctctttctta
cttcagcatgatgcagacatcaacgcccagacaaaaggccttttgacccctttgcacctt
gctgctgggaacagagacagcagagacaccctggaactcctcctgatgaatcgttacatc
aaaccagagctgaagaacaactcacgagaaactgcttctgatatcgccaggaggacaagc
atctatcactacctctttgaaatcgcggaaggctgtacaaacacttcacctccgccttaa

DBGET integrated database retrieval system