KEGG   Rattus norvegicus (rat): 315564
Entry
315564            CDS       T01003                                 

Gene name
Robo3
Definition
(RefSeq) roundabout guidance receptor 3
  KO
K06755  roundabout, axon guidance receptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    315564 (Robo3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    315564 (Robo3)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  ROBO family
   315564 (Robo3)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 Ig_6 Ig_4 Pur_ac_phosph_N CBX7_C
Other DBs
NCBI-GeneID: 315564
NCBI-ProteinID: NP_001101605
RGD: 1311018
Ensembl: ENSRNOG00000030016
UniProt: D3ZKA2
Position
8q21
AA seq 1305 aa
MPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATAREDPRAHRLLLPSGA
LFFPRIVHGRRSRPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVGEP
AVMECVPPKGHPEPLVTWKKGNTKLKEEEGRITIRGGKLMMSHTFKSDAGMYMCVASNMA
GERESGAAELVVLERPSFLRRPINQVVLADAPVNFLCEVQGDPQPNLRWRKDDGELPTGR
YEIRSDHSLWIEQVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQFVTKPQNQTAAPGE
NVSFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPMGRLLVSPRGQLNITEVKIGDGGYY
VCQAVSVAGSILAKALLEIKGASIDGLPPIILQGPANQTLVLGSSVWLPCRVIGNPQPNV
QWKKDETWLQGDNSQFNLMDNGTLYIASVQEMDMGFYSCVAKSSIGEATWNSWLRKREHW
GASPGPATEPGNPPGPPSQPIVTEVTTNSITLTWKPNPQSGARATSYVIEAFSQAAGNTW
RTVADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVQTQDSSLSRPVEDPW
KGQQGLAEVAVRMQEPIVLGPRTLQVSWTVEGPGQLVQGFRVSWRIAGLDQGSWTALDVQ
SPHKQSTVLRGLPPGSQIQIKVQVQGQEGLGAESPSVTRSIPEEAPSGPPQGVAVALGGD
RNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSVMFRGLLPGLLYR
AIVAAATSAGVGVASAPVLVQLPFPPVAEPGPEVSEGLAERLSRVLRKPAFLAGSSAACG
ALLLGLCAALYRRQKQRKELSHYTASFAYTPAVSFPHSEGLSGSSSRPPMGLGPAAYPWL
ADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGANAPGEGPVYSTI
DPVGEELQTFHGGFPQHSSGDPSTWSQYAPPEWSEGDSGARGGKGKLLGKPVQMPSLSWP
EALPPPPPSCELSCPEGPEEELKGSSDLEEWCPPMPEKKHLIDSRSSGACMVAPARGETP
SPTSSYGQQSTATLTPSPPDPPQPPSDIPHLHQMPRRVPLGPSSPLSVSQPALSSHDGRP
VGLGAGPIVSYHPSPSPVPSTASSAPGRTRQVTGEMTPPLHGHRARIRKKTKALPHRREH
SPGDLPPPPLPPPEEETSWPLGLRAAGSMSSLEREHSGERRVAQAVPLGAQPPGAQRGPH
PDGKESQGNGRGLEACRSPQSPQIQLDSRVWSTLILSLISFTSSK
NT seq 3918 nt   +upstreamnt  +downstreamnt
atgccacgcatcgtggagcagccgccagatctgctcgtttccaggggcgagccggccact
ctgccctgccgtgctgaaggccggcctcgacccaacatcgagtggtacaagaatggggcg
cgcgtggccactgcacgcgaggatccgcgggctcaccgcctgctgctgcccagcggcgcc
ctcttctttccccgcatcgtgcacgggcgtcgctctcggcctgacgagggtgtctacacc
tgtgtggctcgcaactacctgggagcagcggctagcagaaacgcctctctggaagtagct
gtcctccgagacgatttccggcaatctcctgggaacgtggtggtagcagtgggggagcca
gcagtaatggaatgcgtgccccctaagggtcacccagagcctttggtgacctggaagaag
ggcaatacaaagcttaaggaagaggagggaaggatcaccatacgtggaggaaagctgatg
atgtcacatacattcaagagtgatgctggcatgtacatgtgtgtagcctccaacatggct
ggagaacgagagagtggggcagctgaacttgtggtactggagcgtccctcatttctgcgt
agaccaataaaccaggttgtcctggctgatgcccctgtgaatttcctgtgtgaggtgcag
ggagatccccagcccaatctacgctggcgcaaggatgatggggagctgcccactggcagg
tatgagattcggagtgaccacagcctttggatcgagcaagtgagtgctgaagacgagggg
acttacacctgtgtggcagaaaacagtgtgggccgagcagaggcatctggctccctcagt
gttcacgtcccaccacagtttgtgactaagccccagaaccagacagcagctcctggagaa
aacgtgtctttccaatgtgagaccaaaggaaacccaccacctgccatcttctggcagaag
gaagggagtcaagtcttgcttttccctagtcagtcactccagcccatgggacgcctctta
gtctctccaagaggccagctcaacatcactgaagtaaagatcggggatggtggctactat
gtgtgccaggctgtcagtgtggctggtagcatcctggctaaggccctgttagagataaaa
ggagcctccatagatggactacctcccatcattctccagggaccagccaatcagacattg
gtacttggctcttctgtgtggctgccatgcagagtgattggaaaccctcagcccaatgtc
caatggaagaaggatgagacgtggctgcagggggataactcacagttcaacttaatggac
aacggcacactatacattgccagtgtacaggagatggacatgggtttctacagctgtgtg
gccaagagttccataggggaggccacatggaatagctggcttaggaagcgagaacattgg
ggagcatcaccaggtccagcaacagaacccggtaatcctccaggccctccctctcagcca
atagtcacagaggtaaccacaaacagcattaccttgacctggaagcccaatccacagtct
ggggccagagctacctcctatgtgatagaggccttcagccaagcagctggcaacacgtgg
cggacggtggcagatggggtacagctggaaacgcacaccgtcagcggcctgcagcccaat
accatctacctattcctcgtgagagctgttggagcctggggcctcagtgaacccagtcct
gtctctgagcctgttcaaacccaggacagcagcctatctaggccagtggaggacccgtgg
aaaggccagcaaggactggctgaagtggccgtgcgaatgcaggagcccatagtccttgga
cccagaactctgcaggtgtcctggactgtagagggccctggccagctggttcagggattc
cgtgtgtcttggaggattgcaggccttgaccagggaagctggacagcgctagacgtacag
agtccacacaagcaaagtactgtgctaagaggcctccccccagggtcccaaatacagatc
aaggtgcaagtccaaggccaggaggggctgggggctgaaagcccctctgtgacccggagc
attcctgaagaggcccccagtggcccccctcagggagtggctgtggccttggggggtgat
cgcaacagcagtatcactgtatcctgggagcctccacttccctcccagcaaaatggggtt
atcactgaataccagatctggtgcctgggtaatgaaagccgattccacctcaatcgatct
gcagcaggctgggcacgctctgtgatgttccggggactgctaccgggcctgctctataga
gccatagtggcagcagctaccagcgctggcgtgggcgtggccagtgccccagtgctagtg
cagctgccattccctccggttgcggagcccgggcctgaggtcagcgaggggctggcggaa
cggttgtctagggtgctgcggaagcctgctttcctggctggcagcagcgcggcctgtggg
gcgctgcttctcgggctctgcgccgccctctatcggcgccagaagcaacgcaaagagctc
agtcattataccgcctcctttgcctacacacctgcagtgtcctttccacactcagagggc
ctttctggatccagttccaggccacccatgggccttggccctgctgcctacccatggctg
gcagactcctggccccacccatctcgaagtccctcagctcaggaaccccgggggagctgc
tgccccagcaatcctgatccagatgatagatactacaatgaggcaggaatctccctgtac
ttggctcagactgcacggggtgctaatgcccctggcgagggtcctgtctacagcaccatt
gacccagtaggggaagagctacagaccttccacggagggttccctcaacattcttctggg
gacccaagcacctggagccagtatgctccccccgaatggagcgagggggacagtggagcc
aggggaggcaaagggaagcttctaggcaaacctgtgcagatgccctctttgagctggcca
gaagccctgccgccacctcccccttcctgtgaattgagctgcccagaggggcctgaggag
gagctgaagggcagttcagatctggaagagtggtgcccaccaatgcctgagaaaaaacac
ttgattgactcacgttccagtggtgcgtgcatggtggctccagcccgaggggaaactccc
tcccctacctcttcttacggacagcagtccacagccactcttaccccctcacctcctgac
cctccccagccccctagcgacatcccacatctccatcagatgcccaggagggtgcccctt
ggaccaagttctcctctcagcgtatcccagcctgctctgagtagccatgatggaaggcct
gttggcctgggtgctggccctatagtctcttatcaccctagccccagtcctgtccctagt
acagccagcagtgcaccagggagaactcgccaggtaactggagagatgactcccccactc
catggacaccgtgcccgaatccggaagaaaaccaaggctcttccacatagaagggaacac
agtcctggggacttgcccccaccacccttgccaccaccagaggaagagacgagctggccc
ttgggtctgagagcagcaggcagcatgtcttccctagagcgagagcacagtggggagagg
agagtggcccaggcagtgcctctaggggcccaacctccaggggcccaacgtggcccccac
cctgatggtaaggagagccagggcaatgggaggggcctggaggcttgcagaagtccccaa
agtccccagattcagttggattcacgtgtctggtcaacattgatattgtctcttatctct
ttcacttcctctaagtaa

DBGET integrated database retrieval system