KEGG   Rattus norvegicus (rat): 315609
Entry
315609            CDS       T01003                                 

Gene name
Cd3e
Definition
(RefSeq) CD3e molecule
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno05142  Chagas disease
rno05162  Measles
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    315609 (Cd3e)
   04660 T cell receptor signaling pathway
    315609 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    315609 (Cd3e)
   04659 Th17 cell differentiation
    315609 (Cd3e)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    315609 (Cd3e)
  09163 Immune disease
   05340 Primary immunodeficiency
    315609 (Cd3e)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    315609 (Cd3e)
   05170 Human immunodeficiency virus 1 infection
    315609 (Cd3e)
   05162 Measles
    315609 (Cd3e)
   05169 Epstein-Barr virus infection
    315609 (Cd3e)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    315609 (Cd3e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    315609 (Cd3e)
CD molecules [BR:rno04090]
 Proteins
  315609 (Cd3e)
SSDB
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_2 m04gp34like Ig_3 ig
Other DBs
NCBI-GeneID: 315609
NCBI-ProteinID: NP_001101610
RGD: 1309222
Ensembl: ENSRNOG00000016069
UniProt: D4A5M2
Position
8q22
AA seq 188 aa
MQWNAFWSILGLSLLAVGTCQEEYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEK
HLVLEDFSEVKDSGYYVCYTESSRKNTYLYLKARVCENCMEVDLTAVSIIIIVDICITLG
LLMVVYYWSKKRKAKAKPVTRGTGTGGRPRGKAQGQNKERPPPVPNPDYEPIRKGQRDLY
SGLNQRAV
NT seq 567 nt   +upstreamnt  +downstreamnt
atgcagtggaacgctttctggagcatcctgggcctcagcctcctagcagttggcacttgc
caggaagagtatgaagtctccatctcaggaaccagtgtagagctgacgtgccctctagag
aatgaggacaacttaaagtgggagaaaaatgacaaagtcctgcctgataagaatgagaaa
cacctggtgctagaggatttctcggaagtcaaggacagtggttactatgtctgctacaca
gaaagctcaaggaaaaacacgtacctgtacctgaaagccagagtgtgcgagaactgcatg
gaggtggacctgacagcagtatccataatcatcattgttgacatctgcatcactctgggc
ttgctgatggtcgtttattactggagcaagaaaaggaaggccaaggccaagcctgtgacc
cgaggaactggtactggtggcaggcccagaggtaaagcccaggggcaaaacaaggagcgg
ccgccacctgttcccaacccagactatgagcccatccgaaaaggccaacgggacctgtat
tctggcctgaatcagagagcagtctga

DBGET integrated database retrieval system