KEGG   Rattus norvegicus (rat): 315807
Entry
315807            CDS       T01003                                 

Gene name
Pigb
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class B
  KO
K05286  GPI mannosyltransferase 3 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
rno01100  Metabolic pathways
Module
rno_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    315807 (Pigb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    315807 (Pigb)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     315807 (Pigb)
Glycosyltransferases [BR:rno01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   315807 (Pigb)
SSDB
Motif
Pfam: Glyco_transf_22 PMT_2
Other DBs
NCBI-GeneID: 315807
NCBI-ProteinID: NP_001101636
RGD: 1307251
Ensembl: ENSRNOG00000059622
UniProt: D3ZYY8
Position
8q24
AA seq 542 aa
MEPETRDHSTAFRNLHSSSGEMKLRKRKSTQYVIAQEKRSRRRDLLGENTYLVLFTIALR
IFNCFLVQTSFVPDEYWQSLEVAHHMVFGYGYLTWEWTERLRGYTYPLIFASIYKILHLL
GKDSVQLLIWIPRLGQALLSAVADLRLYSLTKQLENQEVARWVFFCQLCSWFTWYCCTRT
LTNTMETALTAVALFYYPLEGSRSKNSVKYSLLVALACVVRPTALIPWVPLLFRHLYQEQ
RKLHLTLHHFLPVGFITFSLSLIIDRIFFGQWTLVQFNFLKFNVLQNLGTFYGSHPWHWY
FSQGFPVVLGTHLPFFIHGCFLAPRRLNILLLAVLWTLLVYSMLGHKEFRFIYPVLPFCM
VFCGYSLAHLKAWRKAALSFLLLSNVLLALYTGLVHQRGTLDVMSHIQKVCPRGPDPAPA
SVFIMMPCHSTPYYSHVHCPLSMRFLQCPPDLTGKTQYLDEADTFYLNPLGWLQQEFHSN
VSLPTHLVTFNVLEKEIHAFLTSGNYERTATFFHTHWPERRTGSHIHVYERRLTSRVSTG
GN
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggagcccgagacccgcgatcacagcacggccttccgcaatctccacagcagctctgga
gagatgaagctgcggaagaggaagtccacgcagtatgtgatcgctcaggagaagcgctct
cggcgccgtgatcttcttggagaaaacacttacctggtcttgtttaccattgctctgcga
atatttaactgcttcttagtccagacaagttttgttcctgatgaatactggcagtctctg
gaagttgcacaccacatggttttcggttatggctatttgacctgggaatggacagagaga
ctgagaggttacacttatcccctaatctttgcaagcatttacaagattctgcatcttctg
gggaaagacagtgttcaattactgatctggattcccagacttggccaagctcttctgtct
gctgtagcagacctaaggctttactccctcacgaagcagctggaaaaccaggaagtggca
cgatgggtgtttttctgccagctgtgttcctggttcacgtggtactgctgtacccgaacc
ctcacaaacaccatggagactgccctcactgccgttgcccttttctactatcctctggaa
ggctcgaggtccaagaacagtgtcaagtactccctcctggtggcacttgcttgtgtggtc
cgccccacagcacttatcccgtgggtgccgttactcttcagacatctctaccaagaacag
agaaagctccacctgacgctgcatcattttttacccgtaggattcattaccttcagtttg
tctctgataattgatcgtatcttttttggccaatggacgctggtccagtttaactttttg
aaatttaacgtgctgcagaacttggggacattttatggctctcacccatggcactggtac
ttcagtcaagggtttccagttgtcctggggacccacttacccttcttcattcacggttgc
ttcctggcccctaggaggctcaacatactgctgctggccgtgctgtggacactgctagtg
tacagcatgttgggccacaaagaattcagatttatctatccagttttaccattttgcatg
gtgttctgtggctactcgctagcccacctgaaggcatggaggaaggcagctctgagcttc
ctgctcttgtcaaatgtgctgctggcactctacactggcctagttcatcagagaggcacg
ctggacgtcatgagtcacattcagaaagtctgccccagaggccctgacccagctccggcc
tcagtattcatcatgatgccctgccactccacgccttactacagccatgttcactgccca
ctgtccatgcggtttctccagtgtcccccagacttgactggaaaaactcagtatcttgat
gaagcagatacgttctacttaaaccccttaggctggttacaacaagagtttcacagcaat
gtgtcactccccactcacttggtcaccttcaatgttctggagaaggagatccatgccttc
ctcacctcagggaactatgagaggactgctactttcttccacactcattggccagagcgt
cgaactggcagtcacatacatgtctacgagcggaggttaaccagcagagtcagcacagga
gggaactga

DBGET integrated database retrieval system