KEGG   Rattus norvegicus (rat): 316085
Entry
316085            CDS       T01003                                 

Gene name
Trak1, RGD1307844
Definition
(RefSeq) trafficking kinesin protein 1
  KO
K15369  trafficking kinesin-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    316085 (Trak1)
SSDB
Motif
Pfam: HAP1_N Milton KASH_CCD
Other DBs
NCBI-GeneID: 316085
NCBI-ProteinID: NP_001128037
RGD: 1307844
Ensembl: ENSRNOG00000019262
UniProt: D4ACC5
Position
8q32
AA seq 939 aa
MALAIQLRQPSRAQPLPGLDHTLAGTNSCDVCNSTNLPEVEIISLLEEQLPHYKLRADTI
YGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLEE
KERDLELAARIGQSLLKKNKTLTERNELLEEQVEHIREEVSQLRHELSMKDELLQFYTSA
AEESEPESVCSTPLKRNESSSSVQNYFHLDSLQKKLKDLEEENVVLRSEACQLKTETITY
EEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQQEEITHLLSQIVDLQKKAKSC
AVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNLRNKTMPTSRRY
HSLGLFPMDSLAAEIEGTMRKELQLEEPESPDITHQKRVFETVRNVNQVVKQRSLTPSPM
NIPGSNQSSAMNSLLSSCVSTPRSSFYGSDVSHVVLDNKTNSILLETEAADLGNEEHNKK
PGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLRELAEKGELHSGSLTPTES
IMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGILDP
RPGVVTKGFRTLDVDLDEVYCLNDFEEDDTGDHISLAGLATSTTIQHMETSAHHPGKCMS
QTNSTFTFTTCRILHPSDELTRVTPSLNSAPAPSCSSTSHLKSTPVATPCTPRRLSLAES
FTNVRESTTTMSTSLGLVWLLKERGISAAVYDPQSWDRAGRGSLLHSYTPRMAVIPSTPP
NSPMQTPSASPPSFEFKCTSPPYNNFLASKPASSILREVREKKHVRSSESQTDVSVSNLN
LVDKVRRFGVARVVNSGRAHIPTLTEDQGPLLCGPTGPAHALVPGGLVPEGLPLGCPSGI
RRNRSFPTMVGSSVQMRAPVILTSGILMGAKLPKQTSLR
NT seq 2820 nt   +upstreamnt  +downstreamnt
atggcattggcgattcagctcaggcagccctccagggcccaacctctgccgggactcgac
cacacactggctgggacaaactcctgtgacgtgtgcaacagcaccaaccttccagaagtg
gagatcattagcctgctggaggagcagctgccccactacaagctaagagcggacaccatc
tatggttatgaccacgatgactggctgcacacgcccctcatctccccagatgccaacatc
gacctcacaaccgagcagatcgaagagacgctgaagtacttccttctatgtgccgaaaga
gttggccagatgactaagacatacaatgacattgatgctgtcacaaggcttcttgaggag
aaagagcgggatttggagctggctgcgaggatcggccagtcattgttgaagaagaacaag
accctaactgagaggaacgaactgctggaagagcaggtggagcacatccgggaagaggtg
tctcagctccgccatgagctgtccatgaaggatgagctgcttcagttctacaccagtgcc
gcggaggagagtgagcctgagtctgtctgctcaaccccgctgaagaggaacgagtcatcc
tcctccgtccagaattacttccacctggactctcttcagaagaagctgaaggacctcgaa
gaggagaacgtcgtacttcgatctgaggcttgtcagctgaagacggagaccatcacctat
gaggagaaggagcagcagctggtgaacgactgtgtgaaggagctgagggatgctaacgtc
cagattgcgagcatctctgaggagctggccaagaagacggaagatgccgcccgccagcag
gaggagatcacgcacctgctgtcgcaaatcgtggacttgcagaagaaggcgaaatcctgt
gcggtggaaaatgaagaacttgtccagcacctgggcgctgccaaggatgcgcagcgccaa
ctcacagccgagcttcgagagctggaggataagtacgccgaatgcatggagatgcttcat
gaggctcaggaggaactgaagaacctgcggaacaagacgatgcccacatcccggcgctac
cactccctgggcctgttccccatggactccttggctgccgaaattgagggaaccatgcgc
aaggagctgcagctggaagagccggagtccccagacatcacccaccagaagcgtgtcttt
gagacggtgagaaatgtcaatcaagtggtcaagcagagatcgctaaccccttcccccatg
aacatcccgggctccaaccagtcttcagccatgaactccctcctgtccagctgcgtcagc
accccccgttccagcttctacggcagcgatgtcagccacgtggtcctcgataacaaaacc
aacagcatcctcctggaaactgaggcagccgacctggggaatgaggagcacaataagaag
ccgggcacaccaggcacaccaggctcccatgacctggagacggcacttaggcggctatcc
ctgcgccgagagaactacctatctgagcggaggttcttcgaggaggagcaggagaggaag
ctgcgagagctggctgagaagggagagctgcacagtggctcgctcacgcccaccgagagc
atcatgtccctgggcacacactcacgcttctccgagttcacgggcttctccggcatgtcc
ttcagcagccgctcctacctgcccgagaagctgcagatcgtgaagccactcgaaggttca
gccacacttcaccattggcagcaattggcccagcctcacctcgggggcatcctggacccc
cgccctggtgtggtcaccaagggcttccggactttggacgttgacctggatgaagtgtac
tgccttaacgactttgaggaagatgacacaggtgaccacatttctctggcgggcctagct
acctccacaacaattcagcacatggagacctcagcgcaccaccctgggaagtgcatgtca
cagaccaactcgactttcacctttaccacctgccgcatcctgcacccttcagacgagctc
acgcgggtcacgccaagccttaactcagccccagctccatcttgtagcagcaccagccac
ttgaaatccacgccggtggccacgccatgcaccccccggagactgagcctggccgagtcc
ttcacaaacgtccgcgagtccacgacaaccatgagcacgtccctggggctggtgtggttg
ctgaaggaacgaggcatctcagcggctgtgtacgacccccagagttgggacagagccggc
aggggctccctcctccactcttatacccctaggatggctgtgatcccgtccaccccacca
aattcccctatgcagacgccctcggcctccccgccctccttcgagttcaagtgcacgagc
cctccctacaacaacttcctggcttccaagcctgccagctccatcctgagggaggtgagg
gagaagaagcacgtgaggagcagtgagagccagacggacgtgtctgtctccaaccttaac
cttgtggacaaagtcaggaggtttggggtggccagagtggtgaactcaggacgagcccac
atccccaccttgactgaggatcagggacctctcctctgtggaccgaccgggccagcacac
gctcttgtccctgggggcctggtccccgagggactgcctcttgggtgccccagtggcatc
cgacggaatcgcagcttccccaccatggtcgggtccagcgtgcagatgagggctcctgta
atcctcacctctggcatcttaatgggtgctaagctccccaaacagactagcttgcggtga

DBGET integrated database retrieval system