KEGG   Rattus norvegicus (rat): 316219Help
Entry
316219            CDS       T01003                                 

Gene name
Trerf1
Definition
(RefSeq) transcriptional regulating factor 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_6 zf-C2H2_4 ELM2 zf-C2H2 zf-C2H2_2 Myb_DNA-binding Myb_DNA-bind_7 zf-met
Motif
Other DBs
NCBI-GeneID: 316219
NCBI-ProteinID: NP_001101669
RGD: 1307167
Ensembl: ENSRNOG00000022598
UniProt: D3ZYN9
Position
9q12
AA seq 1120 aa AA seqDB search
MGDQQLYKTNHVAHGGENLFYQQPPLGVHSGLNHSYGNTISGAGMDAPQASPISPHFPQD
TRDGLSLPIGSKNLGQMDASRQGGWGSHAGPGSHVQLRSNLANSNMMWGAPAQVEPTDGY
QYTYSQASEIRTQKLTSGVLHKLDSFTQVFANQNLRIQVNNMAQVLHTQSAVMDGASDSA
LRQLLSQKPVEPSASAIASRYQQVPQQPHPGFTGGLPKPALPVGQHAPQGHLYYDYQQPL
AQMSVQGGQPLQAPQVLSSHMQPLQQHQYYPQPPPQQQQAGLQRLSVQEMQQQQQQQIRP
SPPQQQQQQQQQQQQQQLQLQQRQSSLQIPQYYQPQPMMQHLQEQQQPSMHLQPPSYHRD
PHQYTPEQAHAVQLIQLGSMPQYYYQEPQQPYGHPLYQQSHLSQHLQREDSQLKTYSSDR
QTPALLSSHGDMGPSDTGVADPASSEMTRVTSTLPHQPLLSPSGIHLNSMGSQHQQPSPS
AMWPQMHLPDGRAQPGSPESSGQTKGVFGEQFDAKNKLTCSICLKEFKSLPALNGHMRSH
GGMRASPSLKQEIPRKHPPITAKVEEPLKTPPEKKKFRHRPEPLFIPPPPSSYTPNPTSY
SGATLYQSQLRSPRILGDHLLLDPAHELPPYTPPPMLSPVRQGSGLFSNVLISGHGPGVH
PQLPLTPLTPTPRVLLCRSSSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDV
SAMAQDTHKATLVWKPWPELENQALQQQVENLLNLCCSSALPGGGTNSEFALHSLFEAKG
DVMATLETLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFIFVQKMVK
SKTVAQCVEYYYTWKKIMRLGRKHRTRLAEIIDDCMTSEEEEDAEEEEEDPEEDRKSIKD
EESEVPKTPEPPPAPALAPTEGAPMQAGGQPSGSFICEMPNCGAVFSSRQALNGHARIHG
GTNQVAKTRGAVPSGKQKPGGTQSGYCSVKSSPSHSTTSGETDPTTIFPCKECGKVFFKI
KSRNAHMKTHRQQEEQQRQKAQKAAFAAEMAATIERTTGPVGAPELLPLDQLSLMKPKDV
DILDDDMVQQLGVMDEAEVVGTDLLLDNQDSVLLQGDTEL
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccagcaactgtacaagaccaatcacgtggcccacggtggtgagaacctcttc
tatcaacagccaccccttggcgtgcacagcgggctgaaccacagctatgggaatacaatc
tcgggggctggaatggacgccccgcaggcctcacccatctctcctcacttccctcaagat
actcgggatggtctcagcttgcctattggctccaaaaaccttggccaaatggatgcctcc
aggcagggaggatggggaagccatgcaggacctgggagccatgtccagcttcgtagcaac
ttggccaactcaaacatgatgtggggggcgccggcccaggtggaacccacggatggctac
caatacacgtattcccaggccagcgagatccggacccagaaactcaccagtggtgttttg
cacaagctggactctttcacccaggtgtttgccaaccaaaacctgcgaattcaggtcaac
aatatggcccaggtgctgcacacccagtcagcagtgatggatggagcctctgacagtgcc
ctccgtcagctgctgtctcagaagcctgtggagccctcagcatcagccatagcttctcgc
taccagcaggtgccccagcagcctcaccctggtttcacaggtggactgcccaaaccagcc
cttccagtcgggcagcatgctccccaagggcacctgtattatgactaccagcagcccctg
gcccagatgtccgtgcaaggcggacagccactgcaagcccctcaggtgctgtccagccat
atgcagccattgcagcagcaccagtattacccacagccgccgcctcagcagcagcaagcc
ggactgcagcggctctccgtgcaggagatgcagcagcagcagcagcagcagattcgcccc
tcaccgcctcagcagcagcagcagcagcagcagcaacagcagcaacagcagctccaactg
cagcaacggcagagttcactgcagatacctcagtattatcagccccaacccatgatgcaa
cacttgcaagagcagcagcagccatccatgcacctgcagcccccttcgtaccacagggac
cctcaccagtataccccggagcaggcacatgcggtccagctgatccagctgggctccatg
ccccagtattactaccaggagcctcaacagccctacggtcaccccctctaccagcagagc
cacctgtcccagcacctgcagcgtgaagacagtcagctgaagacctactccagtgatagg
cagaccccagctctgctgagctctcacggggacatgggaccttctgatacaggggtggca
gatccagcaagctcagaaatgacccgggtcaccagtacccttcctcaccaaccgctcctg
tcccccagtgggatccacctcaacagcatgggatctcagcatcagcagccgtctcccagt
gcgatgtggccccagatgcacttacctgatgggagagcccagcctggatctccggaatca
agcggccaaaccaaaggagtgtttggggaacagtttgatgccaagaacaagctgacatgc
tccatctgcctgaaggagttcaaaagcctgcctgccctgaatggccacatgaggtcccac
gggggaatgagggcatcccccagcctcaaacaggaaatcccccggaaacatccgcccatc
accgccaaagttgaggagcccctcaagaccccaccagagaagaagaagttccggcaccgg
cctgagcccctcttcatcccaccaccgccttcttcctatactcccaaccccacctcttac
tcgggggccaccctgtaccagagccaactgcgctccccacgcatcctcggggaccacctg
ctcctggaccccgcccacgaactgcccccctacacaccgccacccatgctgagccccgtg
cgccagggctcagggctcttcagcaatgtcctcatctctggccacggccctggagtgcac
ccccagctgcccctcactcccctcacgcccacgccacgcgtgctgctgtgccgttccagc
agcatcgatggcagcaatgtgacagtcaccccaggacccggagaacagactgtggatgtt
gaaccacgcatcaacattggcttaagattccaagcagagatcccagaactgcaagacgtc
tccgccatggctcaggacacacacaaggccacactggtatggaagccgtggcctgagcta
gaaaaccaggccctccagcaacaagtggagaaccttctgaatttgtgttgttccagcgcg
ctgccaggtggagggaccaattcggaatttgctttgcactctctctttgaggccaaaggt
gacgtgatggctaccctggaaacgctgctgctgcggaagccagtcaggttaaaatgtcat
cctttagcaaactaccactacgccggttctgacaagtggacgtccctagaaagaaaactg
tttaataaagcattggccacttacagcaaagactttatttttgtacagaagatggtgaag
tccaagacagtggctcagtgcgtggagtactactacacttggaagaagataatgcggcta
gggcggaaacaccggacacgcctggcagaaatcattgacgactgcatgaccagcgaagag
gaagaggacgccgaagaggaggaagaggacccggaagaagataggaaatccataaaagat
gaggagagtgaagtacccaagacaccagagccaccgcctgcccctgccctggctcccacc
gagggggcacccatgcaggctggtggccaaccatcaggctccttcatttgtgagatgccc
aactgtggggctgtgttcagctcccgacaggcactgaatggccacgcccgcatccatggc
ggcaccaaccaggtggctaagacccgaggtgctgtcccctctgggaagcagaagccaggt
ggcacccagagtgggtattgctcagtgaagagttcaccatctcacagtaccaccagtgga
gagaccgaccccaccaccatcttcccctgcaaggagtgtggcaaggtcttctttaagatc
aaaagccggaatgcacacatgaaaacccaccggcagcaagaggagcagcagaggcagaag
gctcagaaggcagccttcgcggcagaaatggcagccaccatcgagaggactacggggccg
gtgggggcaccggagctgctgcctctggaccagctgagcctgatgaagcccaaggacgtg
gacatcctggatgatgatatggtccagcagttaggcgtcatggacgaggctgaggtggta
ggcacggatcttctcttggacaaccaagattcagttttgcttcagggtgatacagaactc
taa

DBGET integrated database retrieval system