KEGG   Rattus norvegicus (rat): 317235
Entry
317235            CDS       T01003                                 

Gene name
Zdhhc15
Definition
(RefSeq) zinc finger, DHHC-type containing 15
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    317235 (Zdhhc15)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     317235 (Zdhhc15)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    317235 (Zdhhc15)
SSDB
Motif
Pfam: DHHC
Other DBs
NCBI-GeneID: 317235
NCBI-ProteinID: NP_001034190
RGD: 1562075
Ensembl: ENSRNOG00000002751
UniProt: Q2TGJ4
Position
Xq22
AA seq 337 aa
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIL
YHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVY
TRTGNGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY
SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR
NKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPMRSM
NESQNPLLANEEPWEDNEDESQDYPEGLSSLAVESET
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgcggcggggctggaagatggctctgtctggggggttgcggtgctgccgccgggtactg
tcctgggtgccagtgctcgttattgtcctcgtcgttctctggtcctactatgcctacgtc
tttgaactctgcctggtgactgttttgagcccagcagaaaaagttatctacctcatactc
tatcatgccatttttgtgttctttgcatggacctactggaagtctatctttacactccca
cagcagcccaaccagaagttccacttgtcctatacagacaaggagcgctataaaaatgaa
gagagacctgaggtccagaagcagatgcttgtggatatggccaagaagctaccagtgtac
acaagaaccgggaatggagctgtacggttctgtgaccggtgtcatctaatcaagccagac
cgctgccatcactgttctgtctgtgccatgtgtgttttaaaaatggaccatcattgccca
tgggttaataactgcattggattttccaactacaaattcttccttcagttcttagcgtat
tccgttctctactgcctgtacattgctacaacagtcttcagctacttcatcaaatactgg
agaggggaattgcccagtgtgcgctctaagttccatgtcctctttcttctctttgtggcc
tgcatgttttttgtcagccttgtgattctctttggttaccattgttggcttgtcagcaga
aacaaaactaccttagaggccttctgcacaccagtatttacaagtggaccagagaaaaat
gggttcaatcttggcttcatcaagaatattcagcaggtgtttggcgataataagaagttc
tggttaatacctattgggtccagccctggtgatggacactcctttcctatgaggtctatg
aatgagtcccagaacccgctactggcaaatgaggaaccctgggaagacaacgaggatgaa
agtcaagattatccagaaggcttgtcgtcacttgctgtggagtcagaaacatag

DBGET integrated database retrieval system