KEGG   Rattus norvegicus (rat): 360417Help
Entry
360417            CDS       T01003                                 

Gene name
Ptprq, rPTP-GMC1
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, Q
  KO
K16910  receptor-type tyrosine-protein phosphatase Q [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    360417 (Ptprq)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     360417 (Ptprq)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    360417 (Ptprq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Y_phosphatase Pur_ac_phosph_N fn3_2 Y_phosphatase3 DSPc PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 360417
NCBI-ProteinID: NP_075214
RGD: 620779
Ensembl: ENSRNOG00000056915
UniProt: O88488
Position
7q21
AA seq 2302 aa AA seqDB search
MMDFHFSFLFLLIGTSESQVDVSSSFDGTGYDITLSSVSATTYSSPVSRTLATNVTKPGP
PVFLAGERVGSAGILLSWNTPPNPNGRIISYVVKYKEVCPWMQTAYTRARAKPDSLEVLL
TNLNPGTTYEIKVAAENNAGIGVFSDPFLFQTAESAPGKVVNLTVEALNYSAVNLIWYLP
RQPNGKITSFKISVKHARSGIVVKDVSLRVEDILSGKLPECNENSESFLWSTTSPSPTLG
RVTPTVRTTQSSSTAARSKISSVWKEPISFVVTHLRPYTTYLFEVSAVTTEAGYIDSTIV
RTPESVPEGPPQNCIMGNVTGKAFSISWDPPTIVTGKFSYRVELYGPSGRILDNSTKDLR
FAFTHLTPFTMYDVYVAAETSAGVGPKSNLSVFTPPDVPGAVFDLQIAEVEATEIRITWR
KPRQPNGIISQYRVKVSVLETGVVLENTLLTGQDESISNPMSPEIMNLVDPMIGFYEGSG
EMSSDLHSPASFIYNSHPHNDFPASTRAEEQSSPVVTTRNQYMTDITAEQLSYVVRRLVP
FTEHTISVSAFTIMGEGPPTVLTVRTREQVPSSIQIINYKNISSSSILLYWDPPEYPNGK
ITHYTIYATELDTNRAFQMTTVDNSFLITGLKKYTRYKMRVAASTHVGESSLSEENDIFV
RTPEDEPESSPQDVQVTGVSPSELRLKWSPPEKPNGIIIAYEVLYQNADTLFVKNTSTTD
IIISDLKPYTLYNISIRSYTRLGHGNQSSSLLSVRTSETVPDSAPENITYKNISSGEIEI
SFLPPRSPNGIIQKYTIYLKRSNSHEARTINTTSLTQTIGGLKKYTHYVIEVSASTLKGE
GIRSRPISILTEEDAPDSPPQNFSVKQLSGVTVMLSWQPPLEPNGIILYYTVYVWDKSSL
RAINATEASLVLSDLDYNVDYGACVTASTRFGDGNARSSIINFRTPEGEPSDPPNDVHYV
NLSSSSIILFWTPPVKPNGIIQYYSVYYQNTSGTFVQNFTLLQVTKESDNVTVSARIYRL
AIFSYYTFWLTASTSVGNGNKSSDIIHVYTDQDIPEGPVGNLTFESISSTAIHVSWEPPS
QPNGLVFYYLSLNLQQSPPRHMIPPLVTYENSIDFDDLEKYTDYIFKITPSTEKGFSETY
TTQLHIKTEEDVPDTPPIINTFKNLSSTSILLSWDPPLKPNGAILGYHLTLQGPHANHTF
VTSGNHIVLEELSPFTLYSFFAAARTMKGLGPSSILFFYTDESAPLAPPQNLTLINYTSD
FVWLTWSPSPLPGGIVKVYSFKIHEHETDTVFYKNISGLQTDAKLEGLEPVSTYSVSVSA
FTKVGNGNQYSNVVEFTTQESVPEAVRNIECVARDWQSVSVRWDPPRKTNGIIIHYMITV
GGNSTKVSPRDPTYTFTKLLPNTSYVFEVRASTSAGEGNESRCDISTLPETVPSAPTNVA
FSNVQSTSATLTWTKPDTIFGYFQNYKITTQLRAQKCREWEPEECIEHQKDQYLYEANQT
EETVHGLKKFRWYRFQVAASTNVGYSNASEWISTQTLPGPPDGPPENVHVVATSPFGINI
SWSEPAVITGPTFYLIDVKSVDDDDFNISFLKSNEENKTTEINNLEVFTRYSVVITAFVG
NVSRAYTDGKSSAEVIITTLESVPKDPPNNMTFQKIPDEVTKFQLTFLPPSQPNGNIRVY
QALVYREDDPTAVQIHNFSIIQKTDTSIIAMLEGLKGGHTYNISVYAINSAGAGPKVQMR
ITMDIKAPARPKSKPIPIRDATGKLLVTSTTITIRMPICYYNDDHGPIRNVQVLVAETGA
QQDGNVTKWYDAYFNKARPYFTNEGFPNPPCIEGKTKFSGNEEIYVIGADNACMIPGNEE
KICNGPLKPKKQYLFKFRATNVMGQFTDSEYSDPIKTLGEGLSERTVEIILSVTLCILSI
ILLGTAIFAFVRIRQKQKEGGTYSPRDAEIIDTKFKLDQLITVADLELKDERLTRLLSYR
KSIKPISKKSFLQHVEELCTNSNLKFQEEFSELPKFLQDLSSTDADLPWNRAKNRFPNIK
PYNNNRVKLIADVSLPGSDYINASYVSGYLCPNEFIATQGPLPGTVGDFWRMVWETRTKT
LVMLTQCFEKGRIRCHQYWPEDNKPVTVFGDIVITKLMEDIQIDWTIRDLKIERHGDCMT
VRQCNFTGWPEHGVPENTTPLIHFVKLVRTSRAHDTTPMVVHCSAGVGRTGVFIALDHLT
QHINNHDFVDIYGLVAELRSERMCMVQNLAQYIFLHQCILDLLSNKGGHQPVCFVNYSTL
QKMDSLDAMEGDVELEWEETTM
NT seq 6909 nt NT seq  +upstreamnt  +downstreamnt
atgatggattttcatttctctttccttttccttctcattggaacttcagagtcacaggtt
gatgtttccagttcttttgatggcactgggtatgatataacgctatcttcagtttctgcc
acgacctacagctcgcctgtgagtagaacactggcaacaaatgtgacaaaaccggggcct
ccagtcttcctagccggggagagagttggctctgctgggatactcctttcgtggaatacc
cctcctaacccaaatggaagaatcatatcttatgttgttaagtacaaggaagtctgtcca
tggatgcagacagcatatacccgagcgagagcgaagccagacagtctggaggttcttctc
actaaccttaatcctggaacaacatatgagattaaggttgctgctgaaaacaatgctggc
atcggagtgtttagtgacccatttctttttcaaactgcagaaagtgctccgggtaaagta
gttaacctcacagtggaagctctcaactactctgcagtaaacttgatttggtatttacct
cggcaaccaaatggcaaaatcaccagcttcaagatcagcgtcaagcacgccagaagtggc
atagtagtcaaggatgtctccctcagagtagaggacattttgtctgggaaattacctgaa
tgtaatgagaacagcgaatctttcttgtggagtaccaccagcccctctccaaccctgggt
agagtgacacctacagttcgcaccacacagtcatccagcacggcggcacggagtaagatc
agctctgtgtggaaggagcccatcagttttgtggtgactcacttgagaccttacacaacg
tatctctttgaagtctcagccgttaccacggaagcaggatatattgacagcaccattgtt
aggacgccagaatcagtgcctgaaggaccaccccaaaactgtataatggggaatgtcaca
ggaaaggccttttcaatttcctgggacccaccaactattgtcacaggaaagtttagttac
agagttgaattgtatgggccatcagggcggattttggataatagcacgaaagacctccgg
tttgcgtttacacatctcacaccattcacaatgtacgatgtctatgttgctgcggaaacc
agtgctggggttggacccaagtcaaatctttcagtatttactcccccagatgttccagga
gcagtgtttgatttacagatcgcagaggtagaagccacagaaataagaattacttggagg
aaacctcgacaaccaaacggaatcatcagccagtaccgtgtgaaagtgtcagtcctagag
acaggagtagttttggaaaatactctgctcacaggacaagatgagtctataagcaacccc
atgtctccagaaataatgaacctagtagaccccatgataggattctatgagggctcagga
gaaatgtcttcggacctgcactccccggcttcattcatatacaacagccatccacacaat
gactttcctgccagcactagagctgaagagcaaagttcaccagttgtaaccaccaggaat
cagtatatgaccgacatcactgccgaacagctgtcttacgttgtcaggcggcttgtacca
ttcactgagcacacgattagcgtatctgctttcaccatcatgggcgaaggaccaccaacg
gtcctnactgttaggacacgtgagcaagtgccaagctctatccaaattataaactataaa
aatattagttcttcatctattttactgtattgggatcctccagaatatcccaatggaaag
atcactcattacacaatctacgcaacggagctggacacaaacagagcattccagatgacc
actgtagataacagctttctcatcacagggttgaagaaatatacaagatacaaaatgagg
gttgctgcctcaactcatgttggggaaagttctttgtcagaagaaaatgacatctttgtg
agaactccagaagatgagccagaatcatcacctcaagatgtccaagtaactggtgtgtct
ccaagtgaactgagattgaagtggtccccgcctgaaaaacctaacgggatcattattgcc
tatgaggtgctttaccaaaatgcagacaccttgtttgtaaaaaacacctcaaccacagac
atcattataagtgacctgaaaccttacacactctataatatttctatccggtcgtatacc
agacttggccatggcaatcagtcatcctcattgctgtctgtaaggacttcagagactgtg
cctgatagtgcaccagaaaatattacttacaaaaacatttcttcaggagagattgagata
tccttccttcccccaaggagtcccaacggcatcatacaaaaatacacaatttacctcaag
agaagtaatagccatgaggcaagaactataaatacaacctctttgactcaaaccattgga
ggactgaaaaagtatacccattatgtaatcgaggtgtctgctagtacactcaaaggtgaa
ggcattcggagtaggccaataagcatattgaccgaggaagacgctcctgattctcctcct
cagaacttctctgtgaaacagttgtctggtgtcaccgtgatgttgtcatggcaaccaccc
ttggagccaaatggaattatcctctattacacagtttatgtctgggataaatcatctcta
agagctattaatgcaactgaagcatcactggtgttgtctgacttagactataatgttgac
tacggtgcctgtgtaacagctagcaccagatttggcgatgggaacgcaagaagcagcatc
attaactttcgaacaccagagggagagcccagtgatcctcccaacgatgtccactatgtg
aatctcagttcctcatcgataattctcttttggactcctcctgtaaaacctaatggaatc
atacaatattattctgtttattatcaaaatacttcaggtacttttgtgcagaactttaca
cttcttcaagtaaccaaggagtctgacaatgtgacagtgtctgcaaggatatacagactg
gcaatattcagctactatacattttggctaacagcaagtacttcagtcggaaatgggaat
aaaagcagtgacataattcatgtatacacagaccaagacatacctgaaggtcctgttgga
aacctgacttttgagtccatttcatcaactgcaattcatgtgagctgggagccaccatcc
caaccaaatggcctggtcttctactacctttcactgaatttacagcaaagtcccccacgg
cacatgataccacctctggttacctatgaaaacagcatagactttgatgatctggaaaaa
tatactgactatatatttaaaatcactccgtcaacagaaaagggattctctgagacctat
actacccaactacacatcaaaacggaagaagacgttccagacactccaccaataatcaac
acttttaaaaatctttcttctacctccattctcttatcatgggatcccccattaaagcca
aacggtgcaatactaggttaccatttaactttacaaggaccccacgccaaccatactttc
gtcacttccggtaaccacatagtactggaagaactctcgccatttaccttatatagtttt
tttgctgctgcaagaacaatgaaaggactcggtccttccagtattcttttcttttacaca
gatgagtcagcgcctttagcacctccccagaatttgactttaatcaactacacttcagat
tttgtatggctgacatggagcccaagtcctcttcctggcggtattgtaaaagtatatagt
tttaaaattcatgagcatgagactgatactgtattttataagaatatttcaggtcttcag
actgatgccaaacttgagggactggagcctgttagcacctactcagtcagtgtgtctgca
tttaccaaagttggaaatggcaatcagtatagtaatgtggtggaatttacaacccaggag
tctgttccagaggctgtacggaatatagagtgcgtggcacgtgactggcagtcagtatcg
gtgaggtgggacccaccgagaaaaacaaatggaataattattcactatatgataacggtt
ggagggaattctaccaaagtctcccccagagaccccacgtacacgttcacaaaacttctt
cccaatacgtcatacgtctttgaagtaagagcgtcaacatcagccggcgaaggcaatgaa
agcaggtgtgacatcagcacactcccggagacagttcccagtgctcccacaaatgtagcg
ttttctaatgtccagtcaactagtgcaacactaacatggacaaaacctgatactatcttt
ggatacttccaaaattacaagataactactcaacttcgtgctcagaagtgcagagaatgg
gaacctgaagaatgtattgaacatcagaaagatcaatacctctatgaagcaaaccaaaca
gaagaaacagtgcatgggttaaagaagtttcgatggtatagattccaagtggctgctagc
accaatgttgggtacagtaatgcctcggaatggatttctacacaaacgctgcccggccct
cctgacggtcctcctgaaaatgtgcacgtggtcgcaacatcaccctttggtatcaatatc
agctggagtgaacctgctgtcataactggaccaacattctacctgattgatgtcaaatcg
gtagatgatgatgactttaatatttccttcctgaaatcaaatgaagaaaacaaaaccaca
gagattaacaacttagaagtatttacaaggtattctgtggtgatcacagcctttgtagga
aatgttagtcgggcatacacagatgggaagtcaagtgcagaagtgataattacgacttta
gaatcagtgcccaaggacccacctaataatatgacatttcagaagataccagatgaagta
acaaagtttcaattgacattccttccaccttctcagcccaatggaaacatccgagtgtac
caagcactggtttaccgggaagacgatcctactgctgtccagattcataacttcagcatt
atccagaagacggacacctccatcattgcaatgctagaaggcttgaagggtggacataca
tacaacatcagtgtttacgctatcaacagtgctggtgctgggccaaaggtgcagatgcga
ataactatggatattaaagctccagcacgaccaaaatccaagccaattcctatccgtgac
gccacaggaaaactgcttgtgacgtcaacaactatcacaatcagaatgccaatatgctac
tacaatgatgaccacgggccaatcagaaatgtacaagtccttgtggcagaaacaggagct
cagcaagacggaaatgtgacaaagtggtacgatgcatattttaacaaagcaaggccatat
tttacaaacgaaggattccctaatcccccgtgtatagagggaaagacaaagttcagcggc
aatgaagaaatctatgtgataggtgccgataacgcctgtatgatccctggaaatgaagag
aaaatttgcaatggacctctgaaacccaaaaagcagtatttgtttaaatttagagccaca
aatgtcatgggacaatttactgactctgagtactctgaccctattaaaactttaggtgaa
ggcctttcagaaagaactgtggagatcatactgtcagtcactttgtgtatcctctcaata
atcctccttggaacagctatttttgcatttgtaagaattagacagaaacagaaggaaggt
ggtacatactctccccgggacgcagagattatcgacactaaattcaagctggatcagctc
atcacggtggcagacttggaactgaaggatgagagattaacgcggttacttagttatagg
aaatccatcaagccaataagcaagaaatccttcctgcaacacgttgaagagctttgcaca
aacagcaacctaaagtttcaagaggaattttcggaattaccaaaatttcttcaagatctc
tcctcaactgatgctgatctcccttggaacagagcaaagaatcgctttccgaacataaaa
ccatacaataataacagagtgaagctgatagccgacgtaagcctcccgggatcggattac
attaatgccagctatgtctctggatacttatgtccaaatgagtttattgctacccaaggc
ccattgccagggacagtcggagatttttggagaatggtttgggaaaccagaacgaaaaca
ttagtaatgctcacacagtgttttgagaaaggacggatcagatgccatcagtattggcca
gaggacaacaagccagtgacagtctttggagacatagtaattacaaagcttatggaggac
attcagatcgactggaccatcagggatctgaaaattgaaaggcatggagactgcatgact
gtccggcagtgtaacttcactggttggcctgagcatggggttcctgaaaacaccacccct
ttgattcactttgtgaagttggtgcgaacaagcagagcacatgacaccacccctatggtt
gtgcattgcagcgctggggttggaagaacaggagttttcattgctctggaccacttaaca
cagcacataaataaccatgactttgtggacatatatggactagtagctgaactgaggagc
gagagaatgtgcatggtgcagaacctggcacagtacatcttcttacaccagtgcattctg
gatcttttatcaaataaaggaggtcatcagcccgtctgttttgttaactactccacactt
cagaagatggactctttggatgccatggaaggtgatgttgagcttgaatgggaagaaact
accatgtaa

DBGET integrated database retrieval system