KEGG   Rattus norvegicus (rat): 360426
Entry
360426            CDS       T01003                                 

Gene name
Pla2g6, PNPLA9, iPla2
Definition
(RefSeq) phospholipase A2 group VI
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04014  Ras signaling pathway
rno04270  Vascular smooth muscle contraction
rno04666  Fc gamma R-mediated phagocytosis
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    360426 (Pla2g6)
   00565 Ether lipid metabolism
    360426 (Pla2g6)
   00590 Arachidonic acid metabolism
    360426 (Pla2g6)
   00591 Linoleic acid metabolism
    360426 (Pla2g6)
   00592 alpha-Linolenic acid metabolism
    360426 (Pla2g6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    360426 (Pla2g6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    360426 (Pla2g6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    360426 (Pla2g6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    360426 (Pla2g6)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     360426 (Pla2g6)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    360426 (Pla2g6)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3 Patatin
Other DBs
NCBI-GeneID: 360426
NCBI-ProteinID: NP_001257725
RGD: 628867
Ensembl: ENSRNOG00000012295
UniProt: P97570
Position
7q34
AA seq 752 aa
MQFFGRLVNTLSSVTNLFSNPFRVKEVSLADYASSERVREEGQLILLQNASNRTWDCVLV
SPRNPQSGFRLFQLESEADALVNFQQYSSQLPPFYESSVQVLHVEVLQHLTDLIRNHPSW
TVTHLAVELGIRECFHHSRIISCANSTENEEGCTPLHLACRKGDSEILVELVQYCHAQMD
VTDNKGETAFHYAVQGDNPQVLQLLGKNASAGLNQVNNQGLTPLHLACQMGKQEMVRVLL
LCNARCNIMGPGGFPIHTAMKFSQKGCAEMIISMDSNQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCDVDSTSASGNTALHVAVTRNRFDCVMVLLTYGANAGARGEHGNTPLHLAMSK
DNMEMVKALIVFGAEVDTPNDFGETPAFIASKISKQLQDLMPVSRARKPAFILSSMRDEK
RSHDHLLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSM
AYMRGVYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLSDRQPA
ELHLFRNYDAPEAVREPRCTPNINLKPPTQPADQLVWRAARSSGAAPTYFRPNGRFLDGG
LLANNPTLDAMTEIHEYNQDMIRKGQGNKVKKLSIVVSLGTGKSPQVPVTCVDVFRPSNP
WELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGSDIMLDEVS
DAVLVNALWETEVYIYEHREEFQKLVQLLLSP
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcagttctttggacgcctcgttaacaccctcagtagtgtcaccaacttgttctcaaac
ccattccgggtaaaggaggtgtccttggctgactatgcctcaagtgaacgtgttcgagag
gaagggcagctgatcctgttgcagaatgcttccaatcgtacctgggactgtgtcctggtc
agccctaggaacccacagagtggcttccgactcttccaactggagtcagaggcagacgcc
ctggtgaacttccagcagtattcctcccagctgccaccgttctatgagagctctgtgcag
gtcctgcatgtggaggtgctgcagcacctgacggacctcattcggaaccaccccagctgg
acagtgacgcacctggccgtggaacttggcattcgggagtgtttccatcacagccgcatc
atcagctgcgccaacagcacagagaatgaggagggctgtaccccactacatctggcctgc
cgcaagggtgacagtgagattctggtggagttggtacagtactgccacgcccagatggat
gtcactgacaacaaaggagagaccgccttccattatgctgtgcaaggggacaatccccag
gtgctacagctcctaggaaagaatgcctcagccggcctgaaccaggtgaacaaccaaggg
ctgacgccgctgcacctggcctgccagatggggaagcaggagatggtgcgtgtcctgctg
ctctgcaatgcccgctgcaacatcatggggcccggtggcttccccatccacacagccatg
aagttttcccagaaggggtgtgctgaaatgattatcagcatggacagtaaccagatccac
agcaaggatcctcgctatggagccagcccgctccactgggccaagaacgctgagatggcc
cgaatgcttctgaagaggggctgtgacgtggacagcacaagtgcctcggggaacacagcc
ctgcacgtggcggtgacgcgcaaccgctttgactgtgtcatggtgctgctgacctatggg
gccaacgcaggtgcccgaggagagcatgggaacacaccactgcatctggccatgtcgaaa
gataacatggagatggtcaaagccctcattgtatttggggcagaagtagacaccccgaat
gactttggggagactcctgcattcatagcttccaagatcagcaagcagcttcaggacctc
atgcccgtctcccgagcccggaagccagcgttcatcctgagctccatgagggatgagaag
cgaagccatgaccacctgctctgcttggatggagggggcgtgaagggcctggtcatcatc
cagcttctcattgccattgagaaggcctcaggtgtggctaccaaggacctcttcgactgg
gtggcaggaaccagcacaggcggcatcctggccctggccattctacacagtaaatccatg
gcctatatgcgtggcgtgtacttccgtatgaaggatgaggtgtttcggggctcacggccc
tatgagtctgggcccctggaggagttcctgaagcgtgagtttggggagcacaccaagatg
acagatgtcaagaaacccaaggtgatgctgacagggacactgtcagaccggcagccagca
gagctccacctcttccggaattacgacgccccagaggccgttcgggaacctcgctgtacc
ccaaacattaacctgaagccgcccacccagcctgcagaccagttagtatggcgggcagcc
cggagcagtggggcagccccaacctatttccggcccaatggacgcttcttggatggtggg
ctgctggccaacaaccccacactggatgccatgactgaaatccatgagtacaatcaggat
atgatccgcaagggccagggcaacaaggtgaagaaactctccatagtcgtgtctctgggg
acaggaaagtcccctcaagtgcctgtaacctgtgtagatgtctttcgtcccagcaaccct
tgggaactggccaagactgtttttggagccaaggaactgggcaagatggtggtggactgt
tgcacagatccagatgggcgggctgtggatcgtgcccgggcctggtgtgagatggtcggt
atccagtacttcaggctgaacccccagctaggctcagacatcatgctggacgaggtcagt
gatgcagtgctggtcaacgccctctgggagaccgaggtctacatctatgagcaccgggag
gagttccagaagcttgtccagctgctgctatctccctga

DBGET integrated database retrieval system