KEGG   Rattus norvegicus (rat): 360509
Entry
360509            CDS       T01003                                 

Gene name
Dock2
Definition
(RefSeq) dedicator of cytokinesis protein 2 isoform X1
  KO
K12367  dedicator of cytokinesis protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    360509 (Dock2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360509 (Dock2)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    360509 (Dock2)
SSDB
Motif
Pfam: DOCK_N DHR-2 DOCK-C2 SH3_2 SH3_1 DUF1539 SH3_9
Other DBs
NCBI-GeneID: 360509
NCBI-ProteinID: XP_038943067
RGD: 1564189
Position
10
AA seq 1829 aa
MAPWRKTDKERHGVAIYNFQGSGAQHLTLQIGDVVRIQETCGDWYRGYLIKHKMSQGIFP
TSFIHLKEVTVEKRRNIENIIPAEIPLAQEVATTLWEWGSIWKQLYVASKKERFLQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDFGNKILELDLIVRDEDGNILDPDNTSV
ISLFHAHEEATHKITERIKEETCKDQPDYGIYSRISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPHKQMVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIFLICQIV
RIGKMDLKDINVKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVSAENDFL
HSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGNVLPNAICVGAGDKAMNEYHSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLQDGYHELVVLKGDSKKMEDASAYLTLPSYRYHVENKGATLSRSSSSVGGLSVSSRDVF
SISILVCSTKLTQNVGLLGLLKWRMRPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHAQSNEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRRLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQHKTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQRDDGQHQALEKKYCVELLNSILEVLSCQD
AAFTYDHIQEIMVQLLRTVNRTVITMGRDHSLISHFVACMTAILDQMGDQHYSFYIETFQ
TSSDLVDFLMETFIMFKDLIGKNVYPGDWIAMSMVQNRVFLRAINKFAETMNQKFLEHTS
FEFQLWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNKYGDMRRLVGFSIRDMWYKLGQN
KICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEV
EGGRGDEQYMQLLESILMECAAEHPTIAKSVENFVSLVKGLLEKLLDYRGVMTDESKDNR
MSCTVNLLNFYKDHNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS
QVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEVFDYELLSQ
NLTQQAKFYENIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLLS
QFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQ
TFHYSRPVRRGTVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIE
TMSTANEKILMMINQYQSDESLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYSREHP
EDQDKLSRLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
EMPDFDDRRLGRPRSMLRSYRQMSIISLASMNSDCSTPSKVVSESFDLESVTPKTPKVEE
EPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESELKRLSRKHEFMSDTNLSEHATV
PTRVSVLSQMSFASQSMPTIPALTLSVAGVPGLDEASTSPRLSQTFFQVSDSDKKTLKKK
KVNQFFKTMLASKSGEESKQIPDILSTDM
NT seq 5490 nt   +upstreamnt  +downstreamnt
atggccccctggcgcaaaactgacaaggagcggcacggagtggccatctacaacttccaa
ggcagcggagcccagcacctcactctacagattggcgatgtggttcgaatacaggagacc
tgtggagactggtacagagggtacctcataaagcataaaatgtcacagggcatttttcct
acatcctttatccatctcaaggaagtgacagtggagaagagaaggaacatagaaaatatc
atccctgcagagatccctctggcacaagaagtggcaacgactctctgggagtggggaagc
atttggaagcagctctatgtggccagcaaaaaggaacgcttcctccaagtgcagtccatg
atgtacgacctgatggaatggcgctcccagctcctctcgggaacactacccaaggatgag
ttgaaggaactgaagcagaaagtcacatctaagatcgactttggcaacaaaatccttgag
ctggatctcattgtccgagatgaagacggaaacatattggaccctgataataccagcgtc
atcagcttgtttcatgctcacgaggaagcaactcacaaaatcacggagcgcatcaaagaa
gaaacgtgcaaagaccagccagattatgggatttattcgcgaatctcctcatcccccacc
cacagcctctacgtctttgtgagaaactttgtgtgccgaattggggaggatgctgaactc
ttcatgtctctctatgacccccacaagcaaatggtcataagtgagaactatctggtgcga
tggggcagcaaaggattcccaaaggaaatcgagatgctcaataacctgaaggtcgtcttc
acggatcttggaaacaaagacctcaacagggataagattttcttgatctgtcaaatagtc
cgaatcgggaagatggatcttaaggacataaatgtcaagaagtgcacccaggggctgagg
agaccctttggggtggcagtaatggacatcaccgatatcatcaagggcaaggcagagagt
gatgaagagaagcaacattttattccctttcacccggtctcagctgagaatgatttcctt
cacagccttctgggcaaagtcatagcatccaagggcgacagtggagggcaaggcctttgg
gtgaccatgaagatgctggtgggtgacatcattcagatccgcaaggactacccacactta
gtggacaggaccaccgtggtagcccggaagctgggcttcccagagatcattatgccaggg
gatgtcaggaacgacatctacatcactctcttacaaggtgactttgacaagtacaccaag
accacgcagcggaacgtggaagtgattatgtgtgtgtgcacagaggatggcaatgtctta
cctaatgcaatttgtgtgggagccggggacaaggccatgaacgagtatcactcagttgtg
tactaccaagtcaaacagccacgctggatggaaacagtcaaggtggctgtccctattgaa
gacatgcagaggatccatctgcggttcatgttccgtcaccggtcgtcactggaatctaaa
gataaaggagaaaagaactttgctatgtcctatgtgaagctcatgaaagaagacggaacc
actctgcaggacggataccacgagttggtggttcttaagggagacagcaagaaaatggaa
gatgccagcgcttacttgacacttccttcttatcgataccatgtggaaaacaagggagcc
actctgagccggagctccagcagtgttgggggcctttctgtcagctcccgggatgtgttc
tccatttccatcctggtgtgttccacaaagctcacgcagaacgtgggtttgcttggtttg
ctgaagtggcgtatgaggccgcaactactccaggagaatctagagaagctgaagattgtg
gacggagaggaagtagtgaagttcctccaggacactctggatgccctcttcaacatcatg
atggagcatgctcagagtaacgagtatgacatcctcgtctttgatgctttgatctacata
ataggactcattgcagaccggaaattccagcattttaacaccgtgttggaggcttacatc
caacagcatttcagtgctaccttggcctacaagaaattaatgacggtgctgaagacttac
ttggatacctccagtaggggcgagcagtgtgagcccatcctcagaactctcaaggctttg
gaatacgtgttcaagttcattgtccggtccaggagattattctcacagctttacgaaggc
aaagagcagatggagtttgaagaatccatgagacggctcttcgaatctatcaacaacctg
atgaaaagtcagcacaagaccaccattcttttgcaggtggcagctttgaaatacatccca
tcagtccttcacgatgtggaaacagtctttgatgccaagttgctcagccagctcctgtat
gagttctacacttgcatccctcccgtgaagctgcagaagcagaaggttcagtccatgaac
gagatcgtgcagagcaacctcttcaaaaagcaagaatgccgggacattctgcttcctgtc
atcaccaaagagctgaaggagctgctggagcagagggacgatgggcagcaccaggccttg
gagaaaaagtactgtgtggaactgctcaacagcatcctagaggtcctcagctgtcaggac
gcggccttcacttatgaccacatccaggagatcatggttcagctgcttcgcacagtgaac
aggacggtcatcacgatggggcgagatcattctctgattagtcacttcgtggcatgcatg
acagccatcttggaccagatgggcgaccaacactattccttttatattgagaccttccag
accagctcagaccttgtggacttcttgatggaaacattcatcatgttcaaggacctcatt
gggaagaatgtgtaccctggagactggatagccatgagcatggtccagaacagggtcttc
ctcagagctatcaacaagtttgcagaaaccatgaaccagaagtttctagaacacacaagt
tttgagttccagctgtggaacaactattttcatctggcagtggcttttatcactcaggac
tctctacagctggagcagttcacgcacgctaagtacaacaaaatcctgaataagtatggg
gacatgagacggctcgtgggattctccatccgtgatatgtggtacaagcttggccagaac
aaaatctgcttcatcccaggcatggtgggacctatattagagatgacacttatcccagag
gctgagctcaggaaggccaccatccccatcttcttcgacatgatgctgtgcgaatatcaa
aggactggggctttcaaaaagtttgaaaatgaaatcatcctgaagctggaccatgaggtg
gaaggaggccggggggatgagcagtacatgcagctgctggagtccatcctcatggagtgc
gcagcggaacacccgaccattgccaagtcggtggagaacttcgtgagcttggtcaaaggg
ctgctggagaagctgctggattaccggggagtgatgacggatgagagcaaagacaaccgt
atgagctgcaccgtgaatttgctgaatttctacaaagatcacaaccgggaggagatgtac
attagatacctgtataaattgcgtgaccttcacctggactgtgacaactacacagaggct
gcctacacactcctcctccacacctggcttctcaagtggtcagatgagcagtgtgcgtca
caggtcatgcagacaggccagcagcaccctcagacccaccggcagctgaaggagacactc
tatgagaccattataggctactttgacaaaggaaagatgtgggaggaggccatcagcctg
tgcaaggagctggcggaacagtatgagatggaggtctttgactacgagctgctcagccag
aacctgacccagcaggccaagttctatgaaaacatcatgaagatcctcagacccaaacca
gactactttgccgttggatactatggccaggggttcccctcctttctacggaacaaagtg
ttcatctaccgagggaaggagtacgagcggagagaggacttccagatgcagcttttgagc
cagttccccaacgcagaaaagatgaatacaacctctgccccaggagacgatgtgaagaac
gccccaggccagtacatccaatgtttcactgtgcagcctgtcctggatgaacaccccagg
ttcaagaacaaaccagtgcctgaccagatcataaacttttacaagtccaattatgtgcaa
acattccactactccaggcctgtgcgcaggggcacggtagacccagaaaacgagtttgct
tccatgtggattgagagaacttcgttcctgaccgcgtacaagctgcccggcatcctgcgc
tggttcgaggtagttcacatgtctcagaccacaattagtcctctggagaatgccatcgag
accatgtccacagccaatgagaagatcctgatgatgataaaccagtaccagagtgatgaa
agcctccccatcaaccctctctccatgctcctcaacgggatcgtggaccctgctgtcatg
ggaggcttcgccaagtatgagaaggccttcttcactgaagagtatagcagggagcaccca
gaggaccaggacaagctgagccgcctcaaggacctaattgcatggcagatccccttcctg
ggagcaggaattaagattcacgagaaaagggtgtcagacaacctgcgccccttccatgac
cggatggaggagtgcttcaagaacctgaaaatgaaggtggaaaaggagtatggtgtccga
gagatgcctgactttgacgaccggagactgggccgccccaggtccatgctgcgttcctat
aggcagatgtccatcatctccctggcctccatgaattctgactgcagcacccccagcaag
gtcgtctcagaaagctttgatctagagtcagtgacacccaagactcccaaagtggaggag
gagcccatctccccagggagcactctgccagaggtcaagctgaggagatccaagaaaagg
accaagaggagcagcgtggtgtttgcagacgagaaggcagcagcggagtcagaactgaag
cggctttctagaaagcacgagttcatgagtgacaccaatctctcggagcatgcaaccgtc
cccaccagggtgtctgtcctctctcagatgagttttgccagccagtccatgcccaccatc
ccagccctcacactctcggtggcaggcgtgcctgggttggatgaggccagcacatctccc
cgcctgagtcagaccttcttccaagtctcagacagtgacaagaagaccctgaaaaagaag
aaagtcaatcagttcttcaagaccatgctggctagcaagtcgggtgaagaaagcaagcag
atcccagacatcctgtccacagacatgtga

DBGET integrated database retrieval system