KEGG   Rattus norvegicus (rat): 360521
Entry
360521            CDS       T01003                                 

Gene name
Rufy1
Definition
(RefSeq) RUN and FYVE domain-containing protein 1
  KO
K12482  RUN and FYVE domain-containing protein 1/2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    360521 (Rufy1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    360521 (Rufy1)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    360521 (Rufy1)
SSDB
Motif
Pfam: RUN FYVE zf-RING_5 YabA Trypan_PARP IBR Baculo_IE-1 Crescentin
Other DBs
NCBI-GeneID: 360521
NCBI-ProteinID: NP_001094197
RGD: 1305099
Ensembl: ENSRNOG00000003536
UniProt: F1LR42
Position
10
AA seq 711 aa
MAARGDCRRAGQDSEPEPKPEPESRPEPGLQAGLESGEEFEIVDRSQLPSPGELRSASRT
RAAESWSAPILTLARRATGNLSASCGSALRAAAGLGDGGGGGGERAASKGQMMEERANLM
HMMKLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPL
ELVEKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEF
YEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDSGRE
HERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQ
QQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLEL
EKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKVQSAESSL
QQKDEAIASFEGKTTQVMSSMKQMEERLQQAERARQGAEERSYKLQQELSGRVSALQLQL
SQLRDQCSGLEKELKSEKEQRQTLQRELQHEKDTSCLLQTELQQVEGLKKELRELQDEKA
ELRKVCEEQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATHCKQCEKDFSI
SRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggccgcccgcggagactgccgccgggcggggcaggattcggagccggagccgaagccg
gagcccgagtcgcggccggagcctgggctccaagcaggcctagagtccggggaagagttc
gagatcgtggaccggagccagctgccaagccccggcgagctgcggagcgcgtcgcggact
cgagcggccgaaagctggtcggcgcccatcctgacgctggcgcgcagagccaccgggaac
ctgtcggcgagctgcggcagcgcgctgcgcgcggccgcggggctgggagacggcggcggc
ggcggcggggagcgcgcagcttccaaaggccagatgatggaggagcgtgccaacctaatg
cacatgatgaaactcagcattaaggtcttactccagtctgccctgagcctgggacgcagc
ctggatgcagaccatgctcccttacagcagttctttgtagtgatggagcattgcctcaag
catgggctaaaagtcaagaagagtttcattggccaaaataaatctttctttggtcctttg
gagctggtggaaaaactttgccctgaagcatcagatatagctaccagtgtcaggaatctt
ccagaactaaagacagccgtgggaagaggcagagcgtggctttatcttgctctcatgcaa
aagaaactggcagattatctgaaagtcctcatagacaacaagcatctcctaagtgagttc
tatgagcctgaggccttaatgatggaggaggaaggaatggtgattgtcggtctgctggtg
gggctcaacgttctggacgccaatctctgcttaaagggagaagacctggattctcaggtc
ggagtgattgacttttccctctatctgaaggacgtgcaggatcttgacagcggcagagag
catgaaagaattaccgatgtccttgatcagaaaaattacgtggaggaacttaaccggcac
ttaagctgcacagttggggatcttcaaaccaagatagatggcttggaaaagacgaactca
aagcttcaagaagagctttcagctgcaacagaccgaatttgttccctacaagaagaacag
cagcagctaagagaacagaatgaattaattcgagaaagaagcgagaagagtgtggagata
acaaaacaggacaccaaagttgaactggagacttataagcagacccggcagggcctggat
gaaatgtacagcgatgtgtggaaacagctgaaggaggagaagaaagtccgactggaacta
gaaaaggaactggagttacagattggaatgaagaccgagatggaaatcgccatgaagtta
ctggagaaggacacccatgagaagcaggacacactcgttgccctccgccagcagctggaa
gaagtcaaagcaattaatttacagatgtttcacaaagttcagagtgcagagagcagttta
cagcagaaggatgaagccattgcatcttttgaaggaaaaaccacccaagtgatgtccagc
atgaaacaaatggaggaaaggttacagcaggctgagcgggccaggcaaggggcagaagag
aggagctacaagctgcagcaggagctcagcgggagggtcagtgccctgcagctgcagctg
tcccagctgcgggaccaatgctcaggtctagagaaagaactgaagtcagaaaaagaacaa
agacaaactcttcagagagaactacagcatgagaaagacacctcctgtctgctgcagaca
gagctgcagcaagtggaaggcctgaagaaggagcttcgggagctccaagacgagaaggca
gagttgcggaaggtctgtgaggaacaggagcaagccctccaggaaatgggactgcacctt
agccagtccaaactgaagatggaggacatcaaggaagtaaacaaggctctgaagggccac
acatggttgaaagatgatgaggcaacacattgtaagcagtgtgagaaggacttctccatt
tcccggaggaagcaccactgccggaactgtggccacattttctgcaacacctgctctagc
aacgagctggctctgccctcctaccctaagccagtgcgtgtgtgtgacagctgccatacc
ctgctactgcagcgctgctcttccacagcctcctga

DBGET integrated database retrieval system