KEGG   Rattus norvegicus (rat): 360577Help
Entry
360577            CDS       T01003                                 

Gene name
Nxn
Definition
(RefSeq) nucleoredoxin
  KO
K17609  nucleoredoxin [EC:1.8.1.8]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    360577 (Nxn)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.8  protein-disulfide reductase
     360577 (Nxn)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     360577 (Nxn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin Thioredoxin_6 Redoxin Thioredoxin_7 Glutaredoxin SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 360577
NCBI-ProteinID: NP_001101755
RGD: 1310489
Ensembl: ENSRNOG00000008178
UniProt: D4A0M2
Position
10q24
AA seq 369 aa AA seqDB search
MSVFLEELLGDKLVTGGGEEVDVHSLGARGIALLGLYFGCSLSAPCAQLSASLALKLWNK
YRVSNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSL
ESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQKFEIIFVSADRSEESFKQY
FSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDEDCREFP
WHPKPVLELSDSNAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEA
PLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVETFVNDFL
AEKLKPEPI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcttcttggaggagctgctgggagacaagctggtgacgggcggtggcgaggag
gtggacgtgcactcgctgggcgcccgcggcatcgcgctgctggggctctacttcgggtgc
agcctgagcgccccctgcgcgcagctcagcgccagcctggcccttaaactttggaacaaa
taccgagtctccaacattccatcgctaatattcctagatgccactactgggaaggtcgtg
tgcaggaacgggctcctggtgatccgagatgacccagaaggtctggaattcccttgggga
cctaaacccttccgggaagttatcgctgggcccttgcttagaaacaacgggcagtctctg
gaaagcagcagccttgaggggtctcacgtgggagtctatttctctgcacactggtgtcca
ccctgccgaagccttaccagagtgctggtggaatcctaccggaagatcaaggaggcaggc
cagaagtttgagatcatctttgttagtgcagacaggtcagaggagtctttcaaacagtac
tttagtgagatgccgtggctcgctgtcccctacactgatgaggcccggcggtctcgtctc
aaccgactgtatgggatccaaggcatccccacgctcatcgtgctggacccgcagggggaa
gtgatcactcggcagggccgggtggaggtgctcaatgacgaggactgcagggagttccca
tggcacccgaagcccgtgctggagctctctgactccaacgctgtgcagctcaatgagggt
ccctgcctcgtcctttttgtagactctgaggacgatggagagtctgaggcagccaaacag
ctgatccagccaatagctgagaagatcatcgccaagtacaaagccaaagaagaggaggcg
ccgctgttgttctttgtggccggggaggatgacatgactgactccctgagagattacacc
aacctccccgaggcggcacctttgctcaccattctggacatgtcagcccgggccaagtac
gtgatggatgtagaggagatcaccccagccattgtggagacttttgtgaatgacttccta
gcagaaaagctcaaaccagagcccatctag

DBGET integrated database retrieval system