KEGG   Rattus norvegicus (rat): 360714
Entry
360714            CDS       T01003                                 

Gene name
Gtpbp8, RGD1310025
Definition
(RefSeq) GTP-binding protein 8 (putative)
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MMR_HSR1 RsgA_GTPase GTP_EFTU SRPRB FeoB_N Dynamin_N PduV-EutP AAA_15 TniB AAA_21 Roc AAA_29
Other DBs
NCBI-GeneID: 360714
NCBI-ProteinID: NP_001020186
RGD: 1310025
Ensembl: ENSRNOG00000002044
UniProt: Q5BK22
Position
11q21
AA seq 285 aa
MAATRLWHRTGRLLEIASAFGPWPGVYSTSPAFAEVLRMPQKQLRKVVYPLRELEQHLVT
DSRPGLIEQRLFDPSLEDIGRAESVFAATVRNRIEYLSSAVRLDHAPSLRQPEVCFIGRS
NVGKSSLIKALFSMAPDVEVRISKKPGHTKKMNFFKVGKHFTLVDMPGYGYRAPEDFVDM
VETYLKERNNLKRTFLLVDSVVGITKLDNIAIEMCEEFALPYVMILTKIDKSSKGYLLKQ
VLQIQEFVNTQTQGCFPQLFPISAVTYSGVHLLKCFIADITGSLK
NT seq 858 nt   +upstreamnt  +downstreamnt
atggcggctactaggttatggcatagaacgggaaggctccttgagatagcgtcggcattt
gggccttggcccggggtttacagcacgtcccctgccttcgctgaagtactaaggatgcca
cagaaacagctaaggaaagtagtgtacccgctgcgggaactggagcagcacctcgtcacg
gactctaggcctggcctcatcgaacagagactcttcgacccgagcctggaggacatcggg
agggcggagagcgtcttcgccgccacggtccggaaccgcattgagtacctcagctccgcc
gtccgcctagaccacgccccgagtttgcggcagccggaggtgtgtttcataggccgaagc
aatgttggaaaatcctctttgataaaggccttattttccatggcccctgatgtagaagtc
aggatctcaaaaaaaccggggcacacaaagaaaatgaattttttcaaagttggaaaacat
tttaccttggtggacatgccagggtatggctatagagcacccgaagactttgttgacatg
gtagagacttatctaaaagaacgaaataatttgaagagaacatttttattagtggatagc
gttgttggaattacaaagttagacaatatcgccatagaaatgtgtgaagaattcgcattg
ccttatgtgatgatattaacaaaaattgacaaatcttccaaggggtatcttttaaaacaa
gtgctccagattcaggagttcgttaacacgcagacacaaggctgttttcctcagctgttc
cctataagcgcagtaacctattctggagttcatctgttgaaatgctttatagcagatata
acaggaagtcttaagtaa

DBGET integrated database retrieval system