KEGG   Rattus norvegicus (rat): 360722
Entry
360722            CDS       T01003                                 

Gene name
Pdia5
Definition
(RefSeq) protein disulfide isomerase family A, member 5
  KO
K09583  protein disulfide-isomerase A5 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    360722 (Pdia5)
   04131 Membrane trafficking [BR:rno04131]
    360722 (Pdia5)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     360722 (Pdia5)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Protein disulfide isomerase
   360722 (Pdia5)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    360722 (Pdia5)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_8 Redoxin Thioredoxin_6 TraF Thioredoxin_9 HyaE ERp29_N
Other DBs
NCBI-GeneID: 360722
NCBI-ProteinID: NP_001014147
RGD: 1359236
Ensembl: ENSRNOG00000032327
UniProt: Q5I0H9
Position
11q22
AA seq 517 aa
MARAWGLLLAIGVILPTWLSSTKVSSLIERISDPKDLKKLLRTRNNVLVLYSESEVAAES
HLKLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKIELFHYQDGAFHMQY
DRAVTLKSIVAFLKDPKGPPLWEEDPGAKDVVHIDSEKDFRRLLKKEEKPLLMMFYAPWC
SMCKRIMPHFQKAATQVRGHTVLAGMNVYPPEFENIKEEYNVRGYPTICYFEKGRFLFQY
ENYGSTAEDIVEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHA
PWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATINEALAERFHISAFPTLKYFKNGE
QQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVMFY
APWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQESVKAYPTFHYYHYG
KLVEKYESDRTELGFTSFIRTLREGDLKRLEKRREDL
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcgcgggcgtgggggctgctactggcgattggggtgatcctgccgacatggctgtcc
tccacgaaggtctcttcgctcattgagagaatctccgaccccaaggacttgaagaaactt
ctcaggacccgaaataatgtgctcgtgctttactcagaatctgaggtggcagctgaaagt
catctcaagctactgtccactgtggcccaggcagtgaaaggacaaggcaccatctgctgg
gtggactgtggtgatgcagagagtagaaaattgtgcaagaagatgaaagttgacctcagc
ccaaaggacaaaaagatcgaattattccattaccaggatggtgcgtttcacatgcaatat
gaccgagctgtgacgctgaagtctatagtggcctttctgaaggacccaaaaggtccccca
ctgtgggaagaagaccctggagccaaagatgtcgtgcacattgacagtgagaaggacttc
aggcggctcctaaagaaagaagagaaacctctcctcatgatgttctacgctccctggtgc
agcatgtgcaagaggatcatgccacatttccagaaggctgccacccaagtgcgaggccac
actgtactggctgggatgaatgtctaccccccagagttcgagaacatcaaggaggagtac
aatgtgcgtggctaccccaccatctgctattttgagaagggacggtttctgttccagtac
gagaattatgggtccacggctgaggacatcgtggagtggttgaagaatccacagccgcca
cagccccaggtccccgagactccctgggcagatgagggcggctccgtttatcacctgacc
gatgaagactttgaccagtttgtgaaggagcactcctctgtcctcgtcatgttccacgcc
ccatggtgtggacactgtaagaaaatgaagccggagtttgagagcgcggccgaagtcctc
cacggagatgctgagagctctggtgtccttgcagctgtcgatgccaccatcaacgaggcc
ctggcagaaaggtttcacatctcagcgtttcctactctgaagtattttaagaatggcgag
cagcaagcggtgcctgcgctcagaacaaagaagaagtttattgagtggatgcagaaccct
gaggctcccccgcctccagagcccacgtgggaagagcagcagacgagcgtgttacatctg
gtgggggataacttccgggagaccctgaagaagaagaaacacaccttggtcatgttctat
gccccttggtgcccacactgtaagaaggtcatccctcacttcaccgccacagccgacgcc
ttcaaagatgaccggaagattgcctgtgctgctgtcgactgtgtcaaggacaagaaccaa
gacctgtgtcagcaggagtccgtgaaggcctaccccaccttccactattaccactatggg
aagcttgtagaaaagtatgagagtgaccgcacggaattgggatttaccagtttcatccga
accctccgggagggagacctcaagagactagaaaaaaggagggaggacctgtaa

DBGET integrated database retrieval system