KEGG   Rattus norvegicus (rat): 360775
Entry
360775            CDS       T01003                                 

Gene name
Zfp157, AZ61, RGD1359435
Definition
(RefSeq) zinc finger protein 157
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    360775 (Zfp157)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    360775 (Zfp157)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    360775 (Zfp157)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8
Other DBs
NCBI-GeneID: 360775
NCBI-ProteinID: NP_001163875
RGD: 1359435
Ensembl: ENSRNOG00000001323
UniProt: D3ZFZ1
Position
12q11
AA seq 568 aa
MGLVSFEDVAVDFTWQEWQELDAAQRTLYRDVMLENYSSLVSLGHCVTKPELILRLEHGF
RPWSIGGDASVWSLPGVLEVYTPDESCLENPESHMWPVGSISRNLSNKEMIEAEMKVQLE
LYRGTKPCECKPCMKMVSLPLQRNEQHAYYARVKPYEWKECQKAFCYKSALTQHQRPRTR
LKIYQCTECRKAFPSKSELTVHHRIHTGEKPHECDECGKAFYRKSTLTVHQKTHRGEKPY
ECKECCKAFYYKSTLTEHQRIHTGEKPYVCKECGKAFFYKSNLTRHHRTHTGEKPYECEE
CRKGFSSKSELTSHHRTHTGEKPYQCEECGKAFYCKSTLRVHQKIHTGEKPYECKECQKS
FYYKSTLTEHQRTHTGEKPYECKDCGKAFFYKSQLTRHHRIHTGEKPYECEECRKAFSSK
SELTAHHRTHTGEKPYECEECGKCFCRKSHLTLHHRIHTGEKPYECKDCRKAFFCKSGLA
RHLGTHTHGTNTKNREKHFPATQSSVNIRNDTQVRNPVAIKNEEKHSTINQSSVHMMDFL
ELRSPIDVHNAGKLAFLTHTSFNMNELR
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggattggtgtcatttgaggacgtagccgtggacttcacttggcaggaatggcaggag
ctggatgctgcccagaggaccctctacagggatgtgatgctggagaactacagcagcctg
gtgtccttggggcactgtgtaaccaaaccggagttgatcttgaggttggagcatggattc
cggccatggagcatcggaggagacgcttctgtctggagtctcccaggtgttcttgaagtg
tatactccagatgagagttgcctggaaaatccagagagtcatatgtggccagtgggaagc
atcagcagaaatctttcaaataaagagatgattgaagcagaaatgaaggttcaactggaa
ctttaccgaggtacaaaaccctgtgaatgtaaaccgtgtatgaaaatggttagcctgcca
ttgcagcgcaacgagcagcatgcctactatgcacgcgtgaaaccctacgaatggaaggag
tgtcagaaagccttctgttacaagtcagcgctaactcagcaccagagacctcgtacaaga
ttgaagatctatcagtgtacagaatgcaggaaagcgttcccctccaagtcagaactcact
gtgcatcatagaattcatactggtgagaagccccatgaatgtgacgaatgtggtaaagct
ttctatcgtaagtcaacccttaccgtacatcagaagactcatagaggtgagaaaccttat
gaatgtaaggagtgttgcaaagctttctattataagtcaaccctcactgaacatcagcga
attcataccggcgagaagccttatgtgtgtaaagagtgtggcaaagctttcttctacaag
tcaaacttaactcgccatcatagaactcacacaggtgagaagccttatgaatgtgaagag
tgcaggaaaggtttttcctccaagtcagagctcacttcacatcatagaactcataccggt
gagaagccctatcagtgtgaagagtgtggtaaagctttttactgcaagtcaaccctccgt
gtacaccaaaaaatacatacaggcgaaaagccttatgagtgtaaggaatgtcagaaatct
ttctattataagtcaactcttactgaacatcagagaactcatacaggcgagaagccctac
gaatgtaaagactgtggcaaagctttcttctacaagtcacagttaacacgccatcatcga
attcatacaggtgagaagccttatgaatgtgaagagtgcaggaaagcgttctcctccaag
tcagagctcactgctcatcatagaactcatactggtgagaagccctatgaatgtgaagaa
tgtggcaaatgtttctgtcgcaagtcacacttaactcttcaccatagaatccatacaggt
gagaagccctatgaatgtaaagattgcagaaaagcttttttctgtaagtcaggacttgcc
cgacatctgggtactcatacacatggtactaatacaaagaatagagaaaagcattttcct
gcaactcagagctcagtgaatatcagaaatgatacacaagttcgaaacccagtggctata
aagaatgaagaaaaacactctactataaatcagtcctcagtccatatgatggacttctta
gagttgagaagtcctatagatgtacataatgcaggaaaacttgccttcttaactcatacc
tcattcaatatgaacgaacttaggtga

DBGET integrated database retrieval system