KEGG   Rattus norvegicus (rat): 360904
Entry
360904            CDS       T01003                                 

Gene name
Idua
Definition
(RefSeq) iduronidase, alpha-L-
  KO
K01217  L-iduronidase [EC:3.2.1.76]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00076  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    360904 (Idua)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    360904 (Idua)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.76  L-iduronidase
     360904 (Idua)
SSDB
Motif
Pfam: Glyco_hydro_39
Other DBs
NCBI-GeneID: 360904
NCBI-ProteinID: NP_001165555
RGD: 1310943
Ensembl: ENSRNOG00000000043
UniProt: D3ZE16
Position
14p22
AA seq 643 aa
MRPPRPASAMLIFFAAFLASPLALAETPYLVRVDAARPLRPLLPFWRSTGFCPPLPHDQA
DQYDLSWDQQLNLAYIGAVPHSGIEQVRIHWLLDLITARKSSGQGLIYNFTHLDAFLDLL
MENQLLPGFELMGSPSGYFTDFEDKQQVFEWKDLVSLLARRYIGKYGLTNVSKWNFETWN
EPDHHDFDNVSMTTQGFLNYYDACSEGLRIASPTLRLGGPGDSFHPLPRSPMCWSLLGHC
ANGTNFFTGEVGVRLDYISLHKKGAGSSIAILEQEVAVVEQIQQLFPKFKDTPIYNDEAD
PLVGWSLPQPWRADVTYAALVVKVIAQHQNLLFANSSSSMRYILLSNDNAFLSYHPYPFS
QRTLTARFQVNNTHPPHVQLLRKPVLTVMGLMALLDGEQLWAEVLKAGAVLDSNHTVGVL
ASTHHPEGPSEAWRTTVLIYTSDDTHIHPNDSIPVILHLRGVPPGLELVYVVLYLDNQLS
SPYSAWQHMGQPVFPSAEQFRQMRMVEDPVAEAPRPFPARGRLTLYRKLPVPSLMLVHLC
ARPLEPPGQVSRLRALPLTRGQLVLVWSDEHVGSKCLWTYEIQFSQKGEVYAPINRRPST
FNLFVFSPDTAVVSGFYRVRAVDYWARPGPFSDPVTYLDTPAS
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgcgccccccgcgccccgcctctgctatgctgatattttttgcagcgttcttggcctcg
cccctggcgctggctgagacaccgtacctggtgcgcgtggacgcagcccgcccgctgagg
cctctgctgcccttctggaggagcaccggcttctgccccccactgcctcacgaccaggct
gaccagtacgaccttagttgggaccagcaactgaaccttgcctacataggtgctgtgcct
cacagtggcattgagcaggtccggatacactggctgctggacctcatcacagccaggaag
tcatcaggccagggattgatctacaacttcacccacttggatgcattcctggacctcctc
atggaaaaccagcttctcccgggatttgagctaatgggcagtccttctgggtacttcacg
gactttgaggacaagcagcaggtgtttgaatggaaagacctggtttctctcttggccagg
agatacattggtaagtatgggctgacaaatgtttccaagtggaactttgaaacttggaac
gaaccagaccaccatgactttgacaacgtgtccatgaccacacaaggcttcctgaattac
tatgacgcttgctctgaggggctgcgcattgccagccctactttgaggctgggtggtcct
ggggattccttccaccccctgccaaggtcaccaatgtgctggagcctcctgggacactgt
gccaacggaaccaacttcttcactggtgaggtgggcgtccgcctagattacatctccctg
cacaagaagggtgcaggcagctccatcgccatcctggagcaggaggtggcagtcgtggag
cagatccagcagctcttccccaagttcaaggacacccctatttataatgacgaggcagac
cctctggtaggctggtccctgccgcaaccttggagagccgatgtgacttatgccgcccta
gtggtgaaggtcatcgcacagcaccagaacctgctgtttgccaacagcagctcctccatg
cgctacatactcctcagcaatgacaatgccttcctgagctaccacccgtaccctttctcc
cagcgtacacttactgctcgcttccaggtcaacaatactcacccaccccacgtgcagttg
ctgcggaagccagtactcacagtcatggggctgatggccctgttggatggagagcaactc
tgggcagaggtcttgaaggctggggctgtgttggacagcaaccatacagtgggtgtcctg
gccagcacccatcaccctgaaggtccctcagaggcctggagaaccactgtcctgatctac
actagtgatgacacccacatacaccctaacgacagtatccctgttattcttcatctgcgt
ggagtacctcctggcttggagcttgtctacgtagtactctacttagacaatcaactcagc
agcccctacagtgcatggcagcacatgggccagccagtcttcccctctgcagagcagttc
cgacaaatgcgcatggtggaggacccagtggctgaggcaccgcgcccatttcctgctagg
ggccgcctgaccctgtaccgtaaacttccagtgccatctctcatgctggttcatttatgc
gcacgccccttggagccaccagggcaggtcagccggctccgtgcactgcccctgacacgt
gggcagctggttctggtctggtcggatgagcatgtgggctccaagtgcctgtggacatat
gagatccagttttcccagaagggtgaagtatatgccccaatcaacaggaggccgtctact
tttaacctatttgtgttcagccccgacacagctgtggtctctggcttctaccgagtgcga
gcagtggactactgggcccggccgggccccttctccgaccctgtgacttacctggatacc
cctgcctcctga

DBGET integrated database retrieval system