KEGG   Rattus norvegicus (rat): 361467Help
Entry
361467            CDS       T01003                                 

Gene name
Lpcat1, Aytl2, RGD1311599
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    361467 (Lpcat1)
   00565 Ether lipid metabolism
    361467 (Lpcat1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    361467 (Lpcat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     361467 (Lpcat1)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     361467 (Lpcat1)
Lipid biosynthesis proteins [BR:rno01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   361467 (Lpcat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 361467
NCBI-ProteinID: NP_001094205
RGD: 1311599
Ensembl: ENSRNOG00000017930
UniProt: Q1HAQ0
Position
1p11
AA seq 534 aa AA seqDB search
MRLRGRGPRAAPSSSSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLF
AAFMMLLAWPFALVASLGPPDKEPEQPLALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGR
QALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQ
DSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPN
KLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAK
ALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESAR
MKRGEKIRLPEFAAYLEVPVSDALEDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLAT
IQLAFKMYGSPEDGSIDEADLSCILKTALGISELTVTDLFQAIDQEERGRITFDDFCGFA
EMYPDFAEDYLYPDQTHSDSCAQTPPAPTPNGFCIDFSPEHSDFGRKNSCKKVD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcggggtcgcgggccgcgggccgccccttcctccagctctggggccggcgac
gcgcgacggctagcgcccccggggcggaaccccttcgtgcacgagctgcgactgagcgcc
ctgcagaaggcccaggtggctttcatgacgctgacgctgttccccatccggctcctgttt
gctgctttcatgatgctgctggcctggccttttgcacttgtggcctccctgggacctcct
gataaggagccagagcagcccctggccttatggaggaaggtcgtggacttcctgctcaag
gccatcatgcgcaccatgtggtttgctggcggcttccaccgagtagctgtgaaggggcgg
caggcattgcctactgaggctgctatcctcaccttggccccacattcctcctactttgat
gccatcccggtcaccatgaccatgtcctccattgtgatgaaggcggaaagcagagacatc
ccaatctggggaactctgataagatacatcaggcccgtgttcgtgtcccgctctgaccag
gactctcgaagaaagacagtggaagagatcaagcgacgggcgcagtccaatggaaagtgg
cctcagataatgatttttccagagggaacgtgtacaaataggacctgcctcattaccttc
aaacctggtgcattcattcccggagttcctgtccaacccgtggtgctacgctacccgaac
aaattggacaccatcacatggacgtggcaaggacccggagcgttgaaaatcctgtggctc
accctgtgccagtttcaaaaccaagtggaaattgaatttctgcctgtgtattgtccttct
gaggaggagaagaggaatcctgccctgtatgccagtaatgtgagacgcgtcatggccaag
gccctgggtgtctcagtaacagactacacgtttgaggactgccagctggctctggcagaa
ggacaacttcgcctgcctgccgatacctgcctgctagagtttgccaggctcgtgaggggc
ctcggactaaaaccagaaaatcttgaaaaagatctagacaaatattcagagagcgcaagg
atgaagagaggagagaagatcaggcttccagagtttgcagcctacttggaagttcccgtc
tcagacgcgctagaggacatgttctcgctttttgatgagagtggtggcggtgagatagac
cttcgagaatatgtggtcgccttgtctgtggtgtgcaggccatcccagaccctagccacc
atccagctggcatttaagatgtatgggtctcctgaggatggcagcatagatgaagccgac
ctgtcctgcatcctcaagactgcactgggcatatcagagttgacagtgaccgacttgttc
caggctattgaccaagaggagaggggaagaatcacatttgatgacttctgtgggtttgca
gaaatgtaccctgacttcgcagaggactacttgtaccctgatcagacacattctgacagc
tgcgcacagacacccccagcaccaactcccaatggcttctgcattgacttcagccccgaa
cactcagactttgggagaaagaattcgtgtaagaaagtggactag

DBGET integrated database retrieval system