KEGG   Rattus norvegicus (rat): 361755
Entry
361755            CDS       T01003                                 

Gene name
Aldh18a1, Pycs
Definition
(RefSeq) aldehyde dehydrogenase 18 family, member A1
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
Module
rno_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    361755 (Aldh18a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     361755 (Aldh18a1)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     361755 (Aldh18a1)
SSDB
Motif
Pfam: AA_kinase Aldedh Baculo_LEF-11
Other DBs
NCBI-GeneID: 361755
NCBI-ProteinID: NP_001101994
RGD: 1311431
Ensembl: ENSRNOG00000060047
UniProt: D3ZIE9
Position
1q54
AA seq 795 aa
MLRHVQRSGLQPFSQRLLPWVQSIALPRSHRVQPSAIRHVRSWSNIPFITVPLSRAHGKP
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGLGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLAG
PLLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEAMHSNRILHLLTQEALSIHGVKEAIQLVNTRE
EVEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGRL
KYLHENLPVPQRHFS
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgttgagacatgtgcaacgctccgggctccagcccttcagccaacgtctgctaccgtgg
gtccagtccatagctctgcccagatctcatcgcgtccagccttcagctattagacatgtt
cgttcctggagcaacatcccctttatcacggtacccctcagtcgtgctcatggcaagccc
tttgcccaccgaagcgagctgaagcacgccaagagaattgtagtgaaactcggcagtgcc
gtggtgaccagaggagatgagtgtggcctggcactggggcgcctggcgtctattgtcgaa
caggtctcggtgctgcagaatcagggccgagagatgatgctggtgaccagtggagcggtc
gccttcggcaagcagcgcctgcgccacgagatccttctgtctcagagcgtgcggcaagcc
ctgcactcaggacagaaccatctgaaggagatggcaattccagtcttagaggcccgagcc
tgcgcagccgctggacagagtgggctgatggccttgtacgaggccatgtttacacagtac
agcatctgtgctgcccagattttggtgaccaacctggatttccacgacgagcagaagcgc
agaaatctcaacggcacactacacgagctgcttcggatgaacatcgtccccattgtcaac
accaacgacgccgttgtccccccagctgagcccaacagtgatcttcagggggtaaatgtg
attagcgttaaggacaacgatagcctagctgcccgtctggccgtggagatgaaaactgac
ctcctgattgtcctctcagatgtggaaggcctctttgacagccccccaggctcagatgat
gcaaaactcattgatatattctacccgggagatcagcagtctgtgacatttggaaccaag
tctagagtgggcctagggggcatggaagccaaggtgaaagccgccctctgggctttgcaa
ggtggcacttctgtcgtcattgccaacggaacccaccccaaggtgtctgggcacgtcatc
acagacatcgtggagggaaagaaagttggcaccttcttttcagaagtaaagcctgctggc
cctacggtggagcagcagggggagatggctcggtctggagggagaatgctggccacctta
gagcctgaacagagagctgaaattatcaatcatctggctgacctgctgacggaccagcgg
gaagagatcctgttagccaacaaaaaagacttggaggaagcagagggaagacttgcaggc
cccctgctgaagcgtctcagcctctccacgtctaaactgaacagcctggccatcgggctg
cggcagatcgcagcctcctctcaggagagcgtaggccgtgtcctgcgccggactcggatt
gccaaaaacctggagttagaacaagtgactgtcccaataggtgttttactggtgatcttt
gagtctcgtcctgactgtctaccccaggtggcagccttggccattgcgagtggcaacggc
ttgttgctcaaaggcgggaaggaggctatgcacagcaaccgcattcttcacctcctgacc
caggaggccctctccatccatggagtcaaggaggccatacagctggtaaacaccagagaa
gaagtggaggatctctgccgcctggacaaaataattgacctgatcatccctcgaggctcc
tcccagctggtcagagacatccagaaagctgccaaggggatcccagtgatgggccacagc
gaagggatctgccacatgtacgtggattctgaagccagtgtggacaaggtcacccgactt
gtcagagactccaaatgtgagtacccagctgcctgtaacgccctggagactttgctcatc
caccgagatctgctgagaacacccttatttgaccagatcattgacatgctcagagtggaa
caggtaaaaattcacgcaggccccaagtttgcctcctacctgaccttcagcccctcagaa
gtgaagtcactccggacagagtacggggacctggaagtgtgcatcgaagtggtggacagc
gtccaggaagccattgatcacatccataagtacggcagctcccacacagatgtcatcgtc
accgagaacgagaaaacagccgagttcttcctccagcatgtggacagtgcctgcgtgttc
tggaacgccagtacccgcttctctgatggctaccgatttggactgggagctgaagtagga
atcagtacatcacgaatccatgcccggggaccagtaggactcgagggattgctaactact
aagtggttgcttcgagggcaagaccacgtggtctcagacttctcagagcacggaaggcta
aagtatcttcacgagaacctccctgttccccagaggcatttcagctga

DBGET integrated database retrieval system