KEGG   Rattus norvegicus (rat): 361784
Entry
361784            CDS       T01003                                 

Gene name
Polr1h
Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    361784 (Polr1h)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    361784 (Polr1h)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     361784 (Polr1h)
SSDB
Motif
Pfam: TFIIS_C DZR OrfB_Zn_ribbon zf-ribbon_3 Zn_Tnp_IS1595 DUF3716 RNA_POL_M_15KD zf_UBZ IBR CsgE DNA_RNApol_7kD
Other DBs
NCBI-GeneID: 361784
NCBI-ProteinID: NP_001159772
RGD: 1303114
Ensembl: ENSRNOG00000000779
Vega: OTTRNOG00000001470
UniProt: Q6MFY5
Position
20
AA seq 123 aa
MELARPCSNFQSDLDFCPDCGSVLPLPGVQDTVICPRCGFSIDVRDFGGKVVKTSVVFNK
LGTVIPMSVDEGPESQGPVVDRRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINCKFQEK
EDS
NT seq 372 nt   +upstreamnt  +downstreamnt
atggagctggcccgcccctgctccaactttcaatcagacttggatttctgcccagattgt
ggctccgtcctgccgctgcctggagttcaggatactgtcatctgccctcgttgtggcttc
tccatcgatgtgcgagattttggagggaaggttgtgaagacctcagtagtgttcaacaaa
ctggggactgtcatacctatgtctgtggatgagggacctgaatcccagggaccagtagtt
gacaggcgctgctcccgatgtggtcacgagggaatggcatactacaccagacagatgcgc
tcagctgatgaaggacagactgtcttctatacctgtatcaactgcaagtttcaggaaaag
gaagattcttga

DBGET integrated database retrieval system