KEGG   Rattus norvegicus (rat): 361794
Entry
361794            CDS       T01003                                 

Gene name
Nfkbil1, IkBL
Definition
(RefSeq) NFKB inhibitor like 1
  KO
K09256  NF-kappa-B inhibitor-like protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361794 (Nfkbil1)
   03110 Chaperones and folding catalysts [BR:rno03110]
    361794 (Nfkbil1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    361794 (Nfkbil1)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   361794 (Nfkbil1)
SSDB
Motif
Pfam: Ank_4 Ank_3 Ank_2 Ank_5 Ank
Other DBs
NCBI-GeneID: 361794
NCBI-ProteinID: NP_997674
RGD: 1303310
Ensembl: ENSRNOG00000000839
Vega: OTTRNOG00000001728
UniProt: Q8R2H1
Position
20p12
AA seq 381 aa
MSNPSPQAPEEEASTSVCRPQSSMASVSRRHRRERRFRRYLSAGRLVRAQALLQRHPGLD
VDAGQPPPLHRACARHDAPALCLLLRLGADPAHQDRHGDTALHAAARQGPNAYTDFFLPL
LSRCPSAMGIKNKDGETPGQILGWGPPWDSAEEEEDEEVSKEREWRQKLQGELEDEWQEV
IGRFEDDASRETQEPESFSAWSERLAREHAQKQRRQQLEAEGSRRPPRAEGSSHSWRQQE
EEQRLFRERARVKEKELCESRARRAQEAQGDRGPAPPRARPRAEHPRGAGRGSLWRFGDV
PWPCPGGGDPEAMAAALVARGPPLEEQGALKRYLRVQQVRWHPDRFLQRFRNQIETWELG
RVMGAVTALSQALNRHAEALK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagtaacccctccccccaggccccagaggaagaagcctctacgtctgtctgtcggccc
cagagttccatggcctccgtttcccgccggcaccgccgagagcgacgcttcaggcggtac
ttgtctgcaggacggctggtgcgagcccaggctctcctccagcgacatcccggccttgat
gtggatgctgggcagcccccgcctctccacagggcctgtgcccgccacgatgcccctgcc
ctgtgcttgctgctgcgtcttggcgccgaccctgcccaccaggaccgccatggggacacg
gcgctgcatgctgctgcccgccagggccctaatgcttacacggacttcttcctgccactg
ctgagtcgatgcccatctgccatgggcataaagaataaggatggggagactcctgggcag
attctaggctggggacctccctgggactctgctgaagaggaagaggatgaggaggtttcc
aaggagcgggaatggcggcagaagctacaaggcgagctggaggatgagtggcaggaggtc
atcggaaggtttgaagatgatgcctcccgggagacgcaggagcccgagtccttctcagcc
tggtcagagcgcctggcccgagagcatgcccagaagcagcggcggcagcagctggaggca
gagggatcccgccgacccccaagggctgagggctccagtcacagctggcgacagcaagag
gaggagcagcggcttttccgggagcgagcccgggtcaaggagaaggaactgtgtgagagc
cgagccaggagggcccaagaggctcaaggggaccgagggccagcgcctcccagggcccgg
cctagggcagagcaccctcgaggggcagggaggggcagcctctggcgctttggcgatgtg
ccctggccctgccctggtggaggggacccagaggccatggctgcagctttggtggccagg
ggtcccccactggaggaacagggagctctgaagaggtacttaagagtccagcaggtccga
tggcaccctgaccgattcttgcagcgattccgaaaccagattgagacctgggagctgggc
cgtgtgatgggagccgtgacagccctttctcaggccctgaaccgccatgcagaagccctc
aagtga

DBGET integrated database retrieval system