KEGG   Rattus norvegicus (rat): 361801
Entry
361801            CDS       T01003                                 

Gene name
Rxrb, RXR-beta
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04659  Th17 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05216  Thyroid cancer
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    361801 (Rxrb)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    361801 (Rxrb)
   03320 PPAR signaling pathway
    361801 (Rxrb)
   04919 Thyroid hormone signaling pathway
    361801 (Rxrb)
   04928 Parathyroid hormone synthesis, secretion and action
    361801 (Rxrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    361801 (Rxrb)
   05202 Transcriptional misregulation in cancer
    361801 (Rxrb)
  09162 Cancer: specific types
   05226 Gastric cancer
    361801 (Rxrb)
   05216 Thyroid cancer
    361801 (Rxrb)
   05222 Small cell lung cancer
    361801 (Rxrb)
   05223 Non-small cell lung cancer
    361801 (Rxrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361801 (Rxrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    361801 (Rxrb)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    361801 (Rxrb)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   361801 (Rxrb)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 361801
NCBI-ProteinID: NP_996731
RGD: 3611
Ensembl: ENSRNOG00000000464
Vega: OTTRNOG00000001662
UniProt: A0A0G2QBZ5
Position
20p12
AA seq 518 aa
MSWATRPPFLPPRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAGEQQTLEPEP
GEAGRDGMGDSGRDSRSPDSSSPNPLSQGIPPSSPPGPPHTPSAPPPPMPPPPLGSPFPV
ISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPP
GGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRN
RCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDRILEAELAVEQKS
DQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAG
WNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDK
TELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETYCKQKYPEQQGRFAKLLLRLPA
LRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtcttgggccactcgtccgcccttcctcccgccgcggcatgccgcggggcagtgtggg
ccggtgggggtgagaaaagagatgcattgtggggtcgcgtcccggtggcggcggcggcgg
ccctggctggatcccgcggcggcggcggccggagagcagcaaaccctggagccggagccg
ggggaggctggccgggacgggatgggcgacagcgggcgggattcccgaagcccagacagc
tcctccccaaatcccctttcccaggggatccctccctcttctcctcccggtccacctcac
accccttcagcacctccacctccaatgccaccccctccactgggctcccccttcccagtc
atcagttcttccatggggtctcctggcttgccccctccggctcccccaggattctccggg
cctgtcagcagccctcagattaactccacagtgtcgctccctgggggtgggtctggcccc
cctgaagatgtgaagccaccagtcttaggggtccggggcctgcactgtccaccccctcca
ggtggccctggggctggcaaacgactttgtgcaatctgcggggaccgaagctcaggcaag
cactatggggtttacagctgcgagggctgcaagggtttcttcaagcgcaccattcggaag
gacctgacctactcatgccgagataacaaagactgcacagtggacaagcgccagcggaat
cgctgtcagtactgtcgatatcagaagtgcctggccaccggcatgaaaagggaggcggta
caggaggagcgacaacgggggaaggacaaagacggggatggggatggggctgggggagcc
cccgaggagatgccggtggacaggatcctggaggcagagcttgctgtggaacagaagagc
gaccaaggcgttgagggccctgggggcaccggggggagtggcagcagccccaatgaccca
gtgactaacatctgccaggcggctgacaagcagctgttcacactcgtggagtgggccaag
aggatcccgcacttttcctccctacctctggacgaccaggtcatactgctgcgggcaggc
tggaatgagctcctcattgcgtccttctcccatcggtccatcgatgtccgagatggcatc
ctcctggccacgggtcttcatgtgcacagaaactcagcccattctgcaggcgtgggagcc
atctttgatcgggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggacaag
acggagcttggctgcctgcgggcaatcatactgtttaacccagacgccaagggcctctcc
aaccctggagaggtggagatccttcgggagaaggtgtatgcctcactggagacctactgc
aagcagaagtatcctgagcagcagggccggtttgccaagctgctactacgtcttcctgcc
ctgcgctccatcggcctcaagtgtctggagcacctgttcttcttcaagctcattggcgac
acccccattgacaccttcctcatggagatgcttgaggctccccaccagctagcctga

DBGET integrated database retrieval system