KEGG   Rattus norvegicus (rat): 361815
Entry
361815            CDS       T01003                                 

Gene name
Rnf8
Definition
(RefSeq) ring finger protein 8
  KO
K10667  E3 ubiquitin-protein ligase RNF8 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361815 (Rnf8)
   03400 DNA repair and recombination proteins [BR:rno03400]
    361815 (Rnf8)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     361815 (Rnf8)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    361815 (Rnf8)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     361815 (Rnf8)
SSDB
Motif
Pfam: FHA zf-C3HC4 zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-C3HC4_4 zf-RING_5 zf-RING_UBOX zf-rbx1 Yop-YscD_cpl Prok-RING_4 zf-RING_6 zf-ANAPC11 zf-RING_4 zf-RING_10 Golgin_A5 DUF4407 CENP-F_leu_zip
Other DBs
NCBI-GeneID: 361815
NCBI-ProteinID: NP_001020898
RGD: 1308035
Ensembl: ENSRNOG00000047171
UniProt: Q4KLN8
Position
20p12
AA seq 487 aa
MGEPDPLVSGQLAARRSWCLRRLGMDREWLQLEAGSEVTIGRGFSVTYQLISKVCPLMIS
RNHCVLKQNPEGQWTIMDNKSLNGVWLNRERLAPLQGYCIRKGDHIQLGVPLESKEHAEY
EYEVIEEDRESLAPCLAPKNDHTTEKHKGLRTKRKFSSDGVESLPAEGPSDLRCPLAKGS
SKPAEPEKLHGKGEAASQPLGCLCPTLASLEASERTAGPHACSTLPKVLELYPKKQKACS
PSASQSSLELFKMTMSRMLKLKTQMQEKQIAVLNVKRQARKGSSKKVVRMEKELRDLQSQ
LYAEQAQQQARVEQLEKTFQEEEQHLQGLEKEQGECDLKQQLLQALQEHRALMEELDRSK
KDFEKIIQAKNKELERTKEEKDKVQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNC
AHSFCSFCISEWMKRKVECPICRKDIESRTNSLVLDNCISKMVERLSSDVKERRSVLIRE
RRAKRLL
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgggcgagcccgaccccttggtctcggggcagctcgcggcccgccggagctggtgcttg
cggcggctggggatggaccgcgagtggctacagctggaggctgggagtgaggtgaccata
ggacggggattcagtgtcacgtaccagctgatctcaaaggtgtgccctctgatgatttct
cgaaaccactgcgttctgaagcagaatcctgagggacaatggacgattatggacaataag
agtctgaatggtgtttggctgaacagagagcgtctggcgccgttacagggttactgcatc
cgtaagggagaccacatccagctcggagtgcctctggaaagcaaggagcatgcggagtac
gaatacgaagttatcgaagaagaccgggagagtctggctccctgccttgcccccaagaat
gaccacacaacggaaaaacataaaggcttgagaactaagaggaagttcagttcggatggg
gtagagagtcttccagccgagggcccctcagatctcaggtgcccactggctaaaggctcc
agtaaacccgctgagccagagaagttacacggcaaaggtgaagcggcaagtcagcccttg
ggatgtttgtgccctaccttggcgtctcttgaggcgagtgagaggaccgcggggcctcat
gcttgctctactcttcctaaggtcctcgaactctatcctaagaagcagaaggcctgcagc
ccatcagcatctcagagcagcttagaactgtttaagatgaccatgtccaggatgctcaag
ctgaaaacccagatgcaagaaaagcagattgctgtcctgaacgtcaagaggcaggcccgg
aaggggagctcaaagaaagtcgtgaggatggagaaggagctgcgagacctacagtcccag
ctgtacgcagagcaggctcagcagcaggcaagagtggagcagctggagaagacgttccag
gaggaggagcagcacctccagggtttggagaaagagcaaggagagtgtgatctgaagcaa
cagctgctgcaggctctgcaggagcatcgcgctctaatggaagaactagatcgcagcaag
aaggactttgagaaaatcattcaagccaagaacaaagaattggagcggaccaaggaagaa
aaggacaaggtccaagcacagaaggaggaagttctcagccacatgaacgacgtgctggag
aacgagctccagtgcatcatctgctcagagtacttcatcgaggctgtcaccctgaactgt
gcccacagtttctgctccttctgcatcagtgagtggatgaagcggaaagtggagtgtccc
atctgtcggaaggacattgagtccagaaccaactcgctggttctggacaactgcatcagt
aagatggtggaacgcctgagctcagacgtgaaggagaggagaagcgtcctcattagggaa
cgaagagcaaagagactgttatga

DBGET integrated database retrieval system