KEGG   Rattus norvegicus (rat): 361857Help
Entry
361857            CDS       T01003                                 

Gene name
Traf3ip2, RGD1304768
Definition
(RefSeq) Traf3 interacting protein 2
  KO
K21124  adaptor protein CIKS
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    361857 (Traf3ip2)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    361857 (Traf3ip2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEFIR TIR_2
Motif
Other DBs
NCBI-GeneID: 361857
NCBI-ProteinID: NP_001037713
RGD: 1593240
Ensembl: ENSRNOG00000000595
UniProt: Q498R8
Position
20q12
AA seq 558 aa AA seqDB search
MNRSIPVEVDESEPFPSQLLNPIPESSPEEELEPPAPNTRNTAPSSLSVLQRPPLKLANH
QPVSQQVTCLRAKVLEESEASFLRRHPDLGKDVSSCSSEASEPGSELGALSLEHRFTHME
KRDRWLGPQLSAASPDTGHDSDKSDPSLPMALADSSSSDQEMRPRPGSRPRPWPRHHRNR
AAPDVPTIDTGYDSQPQDVLGIRQLEKPLPLTSSCYLQDLPGPLRSKEFPQFELQRYPAN
APMLPLDPSPQVPWSYQYCRPGGPYHHQAPYGHGYPPAAAYQQVIQPALPEQALLGARVR
GLHPMQKVVLNDSSPQDQEERPAQRDFSFSRLPRDRLCRPPSNGAGAPEESLDRPAELRP
HGPQALSPAAVPRPPSNPLARGTLKTSNLPEELRKVFITYSMDTAMEVVKCVNFLLVNGF
QTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGTGSQLDEDEHGLHTK
YIHRMMQIEFINQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREE
EYVAPPRGPLPTLQVVPL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaagcattcccgtggaggttgacgaatcggagcccttcccgagtcagttgctg
aatccgatcccagaatcttctccagaagaggaattggaaccacctgccccaaatacaagg
aacacggcacccagcagcttgtctgtactccaacgccctcccctgaaacttgcaaatcac
cagcctgtgtcgcaacaggtcacctgcttgcgagctaaagtcctggaggagagtgaagcc
agtttccttagaaggcaccctgatctcggcaaagatgtttcctcctgctcctctgaagcc
agtgagcctgggtctgagcttggagccctctctctagagcatcgctttacacatatggaa
aaacgcgatagatggctgggacctcagctttcagcagcttctcccgacactggccatgac
tcagacaaatcagacccaagtttgcctatggctttggcagactcctccagtagtgaccaa
gagatgaggcccaggcccgggtcccggccccggccctggccccggcaccacaggaacagg
gcagccccagatgtgcccacgatagacactgggtatgattcccagccccaagatgtcctg
ggcatcaggcagctggaaaagcccttgcccctcacctcctcatgttacctgcaggacctc
cctgggcctctcaggtccaaggaatttccccagtttgaactccagaggtatccggcgaat
gcgccgatgctgcctctcgatccttccccacaggttccatggagttatcagtactgtcgt
cccggagggccctatcaccaccaggcgccatatggtcatggctaccctccagcagcagcc
taccagcaagtcatccagcctgctctgcctgagcaggcccttctcggggcaagggtgaga
ggcctgcaccctatgcagaaggtcgtcctgaatgactccagcccccaggaccaagaagag
aggcctgcacagcgagacttctctttctcaaggctcccaagggaccggctctgccgccca
ccatctaatggagctggagctcccgaggagtccttggaccgtcctgcagagctgagacca
catggtccccaggctctgtccccagctgccgtgcctagaccccctagcaaccccttagcc
cgaggaactctgaaaaccagcaatttgccagaggaattacggaaggtctttatcacttat
tctatggacacagccatggaggtggtgaagtgtgtgaacttcctgctggtgaatggcttc
caaaccgccattgacatatttgaggacagaatccggggtattgatatcattaaatggatg
gagcgctaccttcgagataagacagtgatgataatcgtagcaatcagccccaaatacaaa
caggatgtggaaggcactgggtcgcagctggacgaggatgagcatggcttacatactaag
tacattcatcggatgatgcagatcgagtttataaatcagggaagcatgaatttcaggttc
atccctgtgctcttcccaaatgccaagaaggagcatgtgccgacctggctgcagaacact
cacgtgtacagctggcccaagaataagaaaaacatccttctgcggctgctccgagaggag
gagtacgtagctcctccccgaggccctctgcccacccttcaggtggtacctttgtga

DBGET integrated database retrieval system