KEGG   Rattus norvegicus (rat): 361924Help
Entry
361924            CDS       T01003                                 

Gene name
Mynn
Definition
(RefSeq) myoneurin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-Di19 zf-met zf-C2H2_11 DUF3268 zf-C2H2_8 Zn-ribbon_8 zf_UBZ OSTMP1
Motif
Other DBs
NCBI-GeneID: 361924
NCBI-ProteinID: NP_001012178
RGD: 1307889
Ensembl: ENSRNOG00000027923
UniProt: Q5FVP1
Position
2q24
AA seq 468 aa AA seqDB search
MEDFAFIASPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDSVQANPKQRVLTK
KSSQSKKKKKAFNSQNPGRAKALQHHSGVSESASVELFLDANKLSPPAVEQVIQGNDTSE
LELTSVVENTFPAQDIVQTVTVKRKRRKSQSHCALKEHSMSNIASVKSPYELENAGEELD
PRYSKAKPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTG
ERPYKCELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKP
YVCDRCGQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGERPFICE
LCGNSYTDIKNLKKHKTKVHSGTDKNADCSVDDHAVSEQDSIQRSPLSETLDVKPSDMTL
PLALPLGTEDHHMLLPVTDSQSPTSDTLLRSTVNGYSEPQLIFLQQLY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttcgccttcattgctagtccctcttctacagaaatatctagtattactggg
aacatcgagttgaatcaacagacctgtcttcttactcttcgagattataacaatcgggag
aaatcagaagtctccacagactcagttcaggcaaaccctaaacaacgggtattgacaaag
aaatcgtctcaaagtaaaaagaagaaaaaggccttcaattcccagaacccagggcgagct
aaagcactgcaacaccacagtggtgtttcagagagtgcgtctgtcgagttattcctggat
gcgaacaagttgtccccacctgcagtagaacaagtcattcaaggaaatgacacttcagaa
cttgagttgacctcagttgtggagaatacttttcctgcacaagatattgtgcaaactgtt
acagtcaaacggaaacgtcgaaaatcacagtcacattgtgccctgaaagaacactccatg
tctaacatagccagtgtaaagagtccatatgagctggagaacgccggggaagagctggac
ccaaggtattccaaggccaagccaatgtgtaacacgtgtgggaaggtgttttcagaagcc
agcagccttcgaaggcacatgagaatacacaaaggagtcaagccgtacgtctgccacttg
tgtggaaaggcgtttacccagtgcaaccagctgaaaactcatgtgaggactcacacaggg
gaaaggccatataaatgtgaactgtgtgataaaggatttgctcagaaatgccagctggtc
ttccatagtcgcatgcatcatggtgaggaaaaaccctataaatgtgatgtgtgcaattta
cagtttgcaacttctagcaatctcaagattcatgcaaggaaacacagtggagaaaagcca
tatgtctgtgataggtgtgggcagagatttgcccaggccagcaccctgacctatcatgtc
cgcaggcacactggagaaaagccttacgtgtgcgacacctgcggaaaggcctttgctgtc
tctagctctctcatcactcattctcggaaacacacaggagaacgaccatttatctgtgaa
ttatgtggaaattcttacactgacattaaaaacttaaagaagcataaaacaaaggtccat
tctggtacagataaaaatgcagattgcagtgtagatgaccatgctgtaagtgaacaagac
tccatacagagaagtcctttgtcagaaacgctagatgtgaagccttctgatatgactcta
cccttagcgcttcctcttgggactgaggaccaccatatgcttctacctgtcacggatagt
cagtctcctacatcagacacactgctgaggtcaactgtgaatggatattcggaaccacag
ttgatttttttacaacaattatattga

DBGET integrated database retrieval system