KEGG   Rattus norvegicus (rat): 362186
Entry
362186            CDS       T01003                                 

Gene name
Kif18a, RGD1561740
Definition
(RefSeq) kinesin family member 18A
  KO
K10401  kinesin family member 18/19
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362186 (Kif18a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     362186 (Kif18a)
SSDB
Motif
Pfam: Kinesin Microtub_bd DUF4005 DUF2443
Other DBs
NCBI-GeneID: 362186
NCBI-ProteinID: NP_001131114
RGD: 1561740
Ensembl: ENSRNOG00000005037
UniProt: D3ZIA5
Position
3q34
AA seq 811 aa
MKWIAEEAGLGLNLWLCLERLEANSAKLSRSLLVFAYGATGSGKTHTMLGSTAEPGVMYL
TMLDLFKCMDEVKDEKECSTAVSYLEVYNEQIRDLLTNSGPLAVREDAQKGVVVQGLTLH
QPKSSEEILQLLDNGNKNRTQHPTDMNAASSRSHAVFQIYLRQQDKTASINQNVHIAKMS
LIDLAGSERASISGTKGTRFVEGTNINKSLLALGNVINALADTKRRNQHIPYRNSKLTRL
LKDSLGGNCQTIMIAAVSPSSLFYDDTYNTLKYANRAKDIKSSQLKSNVVNLSSHISQYV
KICNMQKAEILMLKEKLKAYEGQKALTDRNDCAKLVHSNVEDKEIERFQEILNCLFQNRE
GMRQEYLKVEMLLKENELKSSYHQQCHKQIEMMCSEDKLEKATCRRDHRLEKLKSNRCVL
EKKKEEMLKQFDENTNWLHRVESEMRLLGQNGDIPEGLNKDLHCHHLHLQNKDLKTQMGH
MMTLAALQEQQHGQTEAVLNALLPVLRKQYWRLKETGLSNAAFDSDFKDIEHLVERKKVV
AWADQTAEHSNQSDVPGTSLLMTFPQLGPIQSIPCCSSMSDPSILKITPQRRTKRKLIPS
PLKVKHTQKSALSERTQLNDSFSKELQPIVYTPEDSRRTVQDLSPPLARASSHSANGMND
NSLKALCRTESPLSRTECKEGLYSTSAICDGIKSLKNNLPEPLPSSKSTLHRVESSSFPT
KDSRSVSTSVPSYMAMTTAAKRKWKFMSSTSDASLKSDESCGLAKRIRQDNSSVKLIREN
RLRVGYKKTTNKTNSNMLRKFRRNTSKENVQ
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgaaatggatagctgaggaagctggcttgggtttgaatttgtggctgtgtttggagcgc
ctggaagccaactcagccaagttgtcgcggtcacttctagtatttgcatatggtgccact
ggatctgggaagactcacacaatgctgggatcaactgctgaacccggggtcatgtaccta
acaatgctggaccttttcaaatgcatggatgaggttaaagacgagaaagagtgtagtact
gcagtctcttatctggaggtatataatgaacagattcgtgacctcttgacaaactcaggg
ccacttgctgtccgggaagatgcccaaaaaggagtggttgttcagggtcttactctacac
cagcctaaatcttcagaggaaatattgcagctactagacaatggaaacaaaaacaggacg
cagcatcccactgacatgaatgctgcgtcttctcgttctcatgctgttttccagatttat
ttacgacaacaggacaaaacagcaagcatcaatcaaaatgtccatatagccaaaatgtca
ctcattgacctcgcaggatctgagcgggccagtatttctggtactaaagggacaagattt
gtagaaggcacaaatattaacaaatctcttctagctcttgggaatgtcatcaatgcctta
gcagatacaaagagaagaaatcagcatattccttacagaaatagtaaacttactcgtttg
ctgaaggattctcttggaggaaactgtcaaactataatgatagctgctgttagtccttcc
tctttattctacgatgacacatataacactcttaagtacgcaaatcgtgccaaagacatt
aagtcttctcagttgaagagcaatgttgtcaacctcagtagtcacatatcacagtatgta
aagatctgcaacatgcagaaggcagagattttaatgttgaaagagaaactaaaggcctat
gaaggacagaaagctctgactgacagaaatgactgtgctaaattagtacattcaaacgtg
gaggacaaagagattgaaagatttcaagaaattctgaactgcttgttccagaatcgagaa
ggaatgaggcaagaatatctgaaggtagaaatgttacttaaagaaaatgaactaaagtca
tcctatcatcaacagtgccataagcaaatagaaatgatgtgttctgaggacaaattggaa
aaggccacttgcagacgagatcacagacttgaaaagttgaaaagcaaccgctgtgtgcta
gagaaaaagaaagaagagatgttgaaacagtttgatgaaaatactaattggctacatcga
gtggaaagtgaaatgcgactcttaggtcaaaatggtgatattcccgagggactcaataaa
gatcttcattgtcaccatttacacctccaaaacaaagacctgaaaacacaaatgggacac
atgatgactctggctgctctccaggagcagcagcatgggcagactgaagcagtactgaat
gctttgcttccagtcctaagaaaacagtattggagattgaaagaaaccggcctgtcaaac
gctgcttttgattctgacttcaaagatattgaacatttagtagagagaaaaaaggtagtg
gcttgggctgaccaaactgctgaacattcaaaccaaagtgatgttcctggtacttctctt
cttatgaccttcccacagcttggaccaattcagtctattccttgttgctcatccatgagt
gaccctagcatacttaagattactccacaaagaagaaccaaaagaaaattaataccttct
ccattgaaagtaaaacatactcagaagtctgcactgtctgaaaggacacagcttaatgat
tcttttagcaaagaacttcagcctattgtttacaccccagaggacagcagaagaactgtt
caggacctctctccacccttagcaagagcgtcctcacattctgcaaatggaatgaatgat
aattccctgaaagcactgtgtagaacagaatctcctctcagcagaaccgagtgtaaagag
ggtttgtactctacatctgctatatgtgatggtatcaaaagcttgaaaaataatttgcct
gaaccactaccgagcagcaaaagcactttacacagggtggagtcttcctcatttccaacg
aaggattctaggtctgtatcaacaagtgtgccatcctacatggcgatgaccactgctgca
aagaggaagtggaaattcatgagttctacatcagatgcttcattaaaatctgatgaaagt
tgtggacttgccaaacgcattcgacaggataattcaagtgttaagctcatccgagaaaac
agactgagagtgggctataaaaaaaccaccaacaaaacaaattcaaacatgcttagaaaa
tttagaagaaacacttcaaaagaaaatgtacaataa

DBGET integrated database retrieval system