KEGG   Rattus norvegicus (rat): 362317
Entry
362317            CDS       T01003                                 

Gene name
Krit1
Definition
(RefSeq) krev interaction trapped protein 1
  KO
K17705  Krev interaction trapped protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    362317 (Krit1)
SSDB
Motif
Pfam: NUDIX_5 FERM_M Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 362317
NCBI-ProteinID: NP_001102088
RGD: 1305929
Ensembl: ENSRNOG00000007937
UniProt: G3V8Z6
Position
4
AA seq 736 aa
MGNPENIEDVYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEIAQGILDYVVETTKPISPANQGIKGKRVVLMKKFPLDGEKTGREAALFIVPSVVKDN
TKYAYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYAAELGQIENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVVEDKERQWVDDFPLHRNACEGD
SELLSHLLDKGFSVNQLDNDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHSEIVQILLTHPDIDRHITDQQGRSPLNVCEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTAQQIMEGMRLSQETQQCFTIWICSENLSLQFKPYHKP
LQQVRDWPEILAELTNLDPQRETPQLFLRRDVGLPLEVEKKIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWINR
ILHEYKNLSMSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYCCFTWQLGDAGTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPSERNS
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgggaaatccagaaaacatagaagatgtatacgttgcagttatccgaccaaagaacact
gccagtctcaactctcgggagtatagagctaagtcctatgaaattttattgcatgaagtt
cccattgaaggacagaaaaagaagagaaagaaagttttgctggaaactaaacttcaaggc
aatagtgaaatagcacaaggcatattggactatgtagtagaaactaccaaaccaatttct
cctgcaaaccaggggatcaaaggaaaacgagtggtgctgatgaagaaatttcctctggat
ggagagaagacaggcagggaagcagcactatttattgttccatcagtcgtcaaagataat
actaaatatgcatatactcccggatgtccaatcttttactgcttacaagatattatgaga
gtttgtagtgaatccagtactcactttgcaacacttacagcaagaatgttaatagccttg
gataagtggttagatgaacgtcatgcacaatctcactttattccagctttattccgacct
tctccccttgaacggataaagacaaatgtcataaaccctgcgtatgctgctgaactaggt
cagatagaaaactcactacatatgggctatagtgcactagaaataaagagtaaaatgcta
gccctagagaaagcagacacctgcatttataaccctttgtttgggtcagatcttcagtat
acaaatcgggtagataaagtggtaataaatccatactttggtctcggagctccagactac
tcaaaaatccaaattcccaaacaggaaaagtggcagcgaagcatgagcagtgttgtggag
gacaaagaacgacaatgggttgatgactttcctttacatcgaaatgcctgtgaaggagat
tcagaattactaagccatcttctggataaaggattttcagtcaaccaactagataatgac
cactgggcacccattcattatgcatgctggtatggaaaggttgaggccactcgcatatta
ttagagaaaggaaagtgcaatccaaaccttttaaatggccagctcagctcaccgcttcat
tttgctgctggagggggacattcggaaatagtacagatccttctaactcacccagacatt
gacagacacataacagaccaacaaggaagatccccattaaatgtttgtgaagaaaacaaa
caaaataactgggaagaagctgcaaaattgttgaaagaagccattaacaagccatatgaa
aaagtccgaatctacagaatggatgggtcatatcgttctgttgaactcaagcacggcaat
aataccacggcgcagcagataatggaaggaatgagactctctcaggaaactcagcaatgc
ttcactatttggatctgttcagagaatcttagtcttcagttcaagccttatcataaaccc
ttgcaacaagttcgtgactggccagaaatacttgctgaattgactaatttggatccacaa
agagaaacaccacagcttttcctaagaagagatgtgggacttcctttagaagttgagaaa
aagattgaagacccactagctattcttattctctttgatgaagccagatataatttactg
aagggcttttatacggctcctgatgctaaactgataacactggcaagtctactgttacaa
atagtttatgggaattatgagagtaaaaaacacaaacaaggtttcttaaatgaagaaaat
ctgaaatccatcgtacctattactaaactgaaaagtaaggcacctcactggataaatcgg
atactccatgagtacaagaaccttagcatgagtgagggtgtcagtaaggaaatgcatcac
ctgcaacgcatgtttctacagaactgctgggaaattcctacatacggagcagcttttttc
acaggacagatatttacaaaggcaagcccaagcaatcataaagtcatccctgtgtatgtg
ggagtgaacatcaaaggacttcatctcctaaacatggaaactaaggccttactcatcagc
cttaagtactgttgctttacgtggcagctgggagatgctggtacttgttttcaaatccac
agtatggaaaataaaatgagctttatagtacacacaaaacaggctggtcttgtggtaaag
ctgctaatgaagttaaatggacaactaatgccctctgaaagaaattcatga

DBGET integrated database retrieval system