KEGG   Rattus norvegicus (rat): 362359
Entry
362359            CDS       T01003                                 

Gene name
Mpp6
Definition
(RefSeq) membrane palmitoylated protein 6
  KO
K24048  MAGUK p55 subfamily member 2/6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    362359 (Mpp6)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   362359 (Mpp6)
SSDB
Motif
Pfam: Guanylate_kin L27 PDZ SH3_2 SH3_1 PDZ_6 PDZ_2 SH3_9 Tricorn_PDZ
Other DBs
NCBI-GeneID: 362359
NCBI-ProteinID: NP_001128454
RGD: 1311833
Ensembl: ENSRNOG00000021579
UniProt: B5DFE0
Position
4q24
AA seq 540 aa
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYESPPSSPEMNIPSLNN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTIAPQQVFVKCHFDYNPFNDNLIPCKEAG
LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGT
ISNKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIV
LNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIG
SILDVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKL
LTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFENLQTAIEKLRTEPQWVPISWVY
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcagcaagttttggaaaaccttacagagctgccctcatctacaggagcagaagaaata
gacctaattttcctcaaggggattatggagaatcccattgtgaaatcacttgctaaggct
cacgagagacttgaagattcaaaattagaagctgtcagtgacaataacttggaattagtg
aatgaaattcttgaagatatcactcctctcataagtgtggatgaaaatgtggcagaactg
gttggtatactcaaggagcctcacttccagtcgctcctggaggcccatgatattgtggca
tcaaagtgttatgaatcgccgccttcaagcccagaaatgaatattccttctctcaataat
cagttattgccagtggacgccatccgtattctcggtattcacaaaagagctggagagcca
ttgggtgtaacattcagggttgaaaataatgatctggtaattgcccgaatccttcatgga
ggaatgatagatcgacaaggtctgcttcatgtgggagatatcattaaggaagtcaatggt
catgaggttggaaacaacccaaaggaattacaagaattattgaaaaatattagtggaagc
gtcaccctaaaaatcttaccaagttacagagatactattgctcctcagcaggtgtttgtc
aagtgtcattttgattataatccattcaatgataacctgataccctgcaaagaagctgga
ctgaagttttccaaaggagaaattcttcagattgtaaatagagaagacccaaattggtgg
caggctagccatgtgaaagagggaggaagtgctggtctgattccaagccagttcctggaa
gagaaaagaaaggcatttgttcgcagagattgggacaattcaggacccttttgtggaact
ataagcaacaagaaaaagaaaaagatgatgtacctcacaaccaggaatgcagagtttgat
cggcatgaaattcagatctatgaggaagtagcaaaaatgccacccttccagcggaaaaca
ttagtgttgatcggagctcaaggtgtgggcagaaggagtttgaaaaacaggttcatagta
ctgaatcctgctagatttggaacaacagtgccatttacttcacggaagccaagagaagac
gaaaaggatgggcaagcatataaatttgtgtcccgatcagagatggaagcagatattaaa
gctgggaagtatctggagcatggggaatatgaagggaacctgtatggaactaagatcggc
tccattctcgacgtcgtccaaaccggacggacttgcattttggatgttaatccacaagca
ctgaaggtgctgcggacctccgagttcatgccttacgtggtgtttattgctgctccagag
ctagagactttgcgtgccatgcacaaggctgtggtggacgcaggaatcaccaccaagctt
ttgacggactctgacttgaagaaaacggtggatgaaagtgcccggattcagagagcatac
aaccactactttgatttgatcatcgtaaatgacaatctagacaaagcctttgagaaccta
caaactgccattgagaaactgaggacggagccacagtgggtccccattagctgggtgtac
tga

DBGET integrated database retrieval system