KEGG   Rattus norvegicus (rat): 362417
Entry
362417            CDS       T01003                                 

Gene name
Il17re
Definition
(RefSeq) interleukin 17 receptor E
  KO
K05168  interleukin 17 receptor E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362417 (Il17re)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    362417 (Il17re)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    362417 (Il17re)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL17 receptor family
   362417 (Il17re)
SSDB
Motif
Pfam: IL17_R_N SEFIR
Other DBs
NCBI-GeneID: 362417
NCBI-ProteinID: NP_001004091
RGD: 735148
Ensembl: ENSRNOG00000009204
UniProt: Q6AZ51
Position
4q42
AA seq 637 aa
MGSPRLAALLLSQPLLFICLAVSAQVACPCLPRWTSHCLLAFRVDKHFAGLQCGWFPLLV
RKSKSSHEFEVCWRHWTPSPFQRKLLGSPSLSQESHRISTHFLAISHRGLRTKRTQPSAA
EGIEHLPGAGSQKHGGPEFSFDLLPEVQAIRVTIPPGPEANVRLCYQWALECEDMSSPFD
TQKIVSGGHTVDLPYEFLLPCMCIEASYLQEDTVRHKKCPFRSWPEAYGSDFWKSIRFTD
YSQHSQMVMALTLRCPLKLEASLCWRQDPVTPCKILPNATAKESEGWYILENVDLHPQLC
FKFSFENSSHVECPHQSGSLPSWTVSMDTQAQQLILHFSTRTYATFSAAWSNPGLGLDSS
MTPVYSISQTQGSVPVTLNLIIPFLRQGSCILVWRSDVQFAWKHLLCPDVSHRHLGLLIL
ALLGLTTLLGVVLVLFCRRLLPGPGRTRPVLLLHAADSEAQRRLVGALAELLRTALGGGR
DVIVDLWEGTHVARIGPLPWLWAARERVAREQGTVLLLWSCAGPSTACSGDPQTASLRTL
SCAAPRQLLLAYFSRLCAKGDIPGPLRALPRYRLLRDLPRLLRALDARPATLATSWSHLG
AKECLKSRLELCHLLELEAAKDDYHGSTNSPCGFSCL
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggggagccccagactggcagccttgctcctgtctcaacctctactgttcatctgcctt
gctgtgtctgctcaggttgcctgcccctgcctgccacgttggaccagccactgtctactg
gccttccgtgtggataagcattttgctggccttcagtgtggctggttccctctcttggtg
aggaaatctaaaagttctcatgaatttgaagtctgttggaggcactggacaccatcaccc
ttccagaggaagctactaggtagcccttccttgtctcaggagagccatcgaatttccacc
cacttcctagccatctcccacagaggcctacgtaccaaaaggacccagccttcagctgca
gaagggatagaacatctccctggagcaggttcacaaaagcatggaggacctgaattctcc
tttgatttgctgcctgaggtacaggctattcgggtgactattcctccaggcccagaggcc
aacgtacgcctttgttaccagtgggcactggaatgtgaggacatgagtagtccttttgat
acccagaaaattgtgtctgggggccacactgtagacctgccttatgaattccttctgcct
tgcatgtgcatagaggcctcctacctgcaggaggacactgtgaggcacaaaaagtgtccc
ttccggagctggcctgaagcttatggctccgacttctggaagtcaatacgcttcactgac
tacagccagcacagtcagatggtcatggctctgacactccgctgcccactgaaactggag
gcctctctctgctggaggcaggacccagtcacgccctgcaaaatccttcccaatgccaca
gcaaaggagtcagaaggatggtatatcctggagaatgtggacttgcacccccagctctgc
tttaagttttcttttgaaaacagtagccatgttgaatgtccccaccagagtggctctctc
ccatcctggactgtgagcatggatacccaggcccaacagctgattcttcacttttcgacg
aggacatatgctaccttcagtgctgcctggagtaacccaggtttggggctggatagctcc
atgactcctgtgtacagcatcagtcagacccagggctcagttccagtgacactgaacctc
attattcccttcttgaggcaggggagctgcatcctggtgtggaggtcagatgtccagttt
gcctggaagcacctcttgtgtcctgatgtctcccatagacacctcgggctcttgatcctg
gcactgctgggtctcaccactctactgggtgtagttctggtcctcttctgccggcgccta
ctgccaggccccggtcgaacaaggccagttttactcctacacgcagcggactcagaggca
cagcgacgcctggtgggagctttggccgaactgctgcggaccgcgctgggtggtggacgc
gacgtgatcgtggatctctgggaagggacgcacgtggctcgcattggaccactgccatgg
ctctgggcagcacgggaacgcgtggcacgggagcagggcactgtgttgctcctttggagc
tgtgcgggccccagcactgcctgcagcggcgacccgcagactgcatcccttcgcaccttg
tcgtgcgctgctccacgccagctgctgctcgcctacttcagtcgcctctgtgccaaaggt
gacattcccgggccgctgcgcgctctaccgcgctaccgcctgcttcgtgatctgccacgc
ctactgagagcgctggatgctcgacctgccaccctagccactagctggagtcaccttgga
gctaaggagtgtttgaaaagtcgcctggagctgtgtcacctgctggaactcgaggctgcc
aaagacgactaccacggttcaaccaatagtccttgtggcttcagttgtctgtag

DBGET integrated database retrieval system