KEGG   Rattus norvegicus (rat): 362426
Entry
362426            CDS       T01003                                 

Gene name
Bms1, Bms1l
Definition
(RefSeq) BMS1 ribosome biogenesis factor
  KO
K14569  ribosome biogenesis protein BMS1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    362426 (Bms1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    362426 (Bms1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  90S particles
   GTPase
    362426 (Bms1)
SSDB
Motif
Pfam: RIBIOP_C AARP2CN GTP_EFTU MMR_HSR1 AAA_16 AAA_22 RNA_helicase
Other DBs
NCBI-GeneID: 362426
NCBI-ProteinID: NP_001094221
RGD: 1308043
Ensembl: ENSRNOG00000006576
Vega: OTTRNOG00000001033
UniProt: B2GV18
Position
4q42
AA seq 1282 aa
MEATDHKKHRKKHSGPKAEKKKKRHLQDLQLGDEEDARKRNPKAFAVQSAVRMARSFHRT
QDLKTKRHHIPVVDRTPLEPPPIVVVVMGPPKVGKSTLIRCLIRNFTRQKLSEIRGPVTI
VSGKKRRLTIIECGCDINVMIDLAKVADLVLMLIDASFGFEMETFEFLNICQVHGFPKIM
GVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYPGAKLFYLSGMVHGEYQNQEIHNLGRFIT
VMKFRPLTWQTSHPYILADRMEDLTNPEDIRTNIKCDRKVSLYGYLRGAYLKTNSQIHMP
GVGDFVASDVSFLPDPCALPEQQKKRCLNEKEKLVYAPLSGVGGVLYDKDAVYVDLGGSH
GFQTVEEAGPTHELVQSLISTHASIDAKMASSRVTLFSDSRPLGSEDVDSQGLWMPKEEK
QVDVETGRVRRKAVFGDTEEESGDDDSEGDEDEMSDDDGMENGSSDDEVEEEEGAKSSSC
KYTTVRGHKRPKLEEQEEDSEADLPAFADSDDDLERSSGGEEEAEEADESSADGASTGER
DTGEASSVGGARGARPPAAHQWGPHPDGQKPSPVRKAALTTSDSGHCTAEEAFPSEDESE
ESELSSEEEDSEHKEVGGTNPQQHRGQKPESENVGDETSDIENLLKEEEDHKEENSSSVE
TSGALKWKEDLSRKAAEAFLRQQQAAPNLRKLIYGTVTEDNEDEDGDASEELGGLFRVSQ
PDKGCKHKADSLDCSRFHVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKLLAEDEELY
GDFEDLETGDVHKGKPGLDTQSEDIEEEEEVKEETGPAEEESAREKHLNKKRKLKELFDA
EYDEGESTYFDDLKGEMQRQAQLNQAEFEDQDDETRVQYEGFRPGMYVRIEIENIPCEFV
QNFDPHYPIILGGLGNSEGTVGYVQMRLKKHRWYKKILKSRDPVIFSVGWRRFQTIPLYY
IEDHNGRQRLLKYTPQHMHCGATFWGPITPQGTGFLAIQSVSGAMPEFRIAATGVVLDLD
KSIKIVKKLKLTGFPFKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAP
EGAFRASFEDKLLMSDIVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTHQLRLA
HGIKLKPNKDSLYKPILRQKKHFNSLHIPKALQKALPFKNKPKTQAKAGKVPRDRQRPAV
IREPHERKVLALLDALSTIHGQKMKKAKEQRHLHNKEHVKMKQKEEEEKLRRQKDLRKKL
FRIQGQKEKRSQKSSLRGAEAT
NT seq 3849 nt   +upstreamnt  +downstreamnt
atggaggccacggatcacaagaaacacaggaagaagcacagtgggcctaaagctgagaag
aaaaagaaaaggcacctgcaggatctacagcttggagatgaggaggatgcccggaagaga
aaccccaaagcttttgccgtgcagtctgctgtgcgcatggcgcggtcctttcacaggact
caggacctaaagacgaaaaggcatcatattccagtggttgaccgaactccactggagccc
ccaccaatagtggtagtggtgatgggccctccaaaagttggaaagagtaccttgatacgg
tgcctgattcggaattttaccagacagaagttgagtgagatcagaggccctgtgacaatt
gtgtcaggtaaaaagcgcagacttaccattattgagtgtgggtgtgacatcaacgtaatg
attgacctagctaaagtagcagatctggtgctaatgcttatagatgccagctttggcttt
gaaatggagacatttgagtttctaaacatttgtcaagtacatggctttcctaaaattatg
ggagttctcacccacttggactccttcaagcacaacaagcaacttaagaagacaaagaag
cgcttaaagcatagattctggacagaagtctacccgggtgccaagctgttctacctttct
ggaatggttcatggagagtatcagaaccaagagattcacaacctgggcagatttatcaca
gttatgaagtttcggcctctcacatggcaaacttctcatccttacatcctggcagacagg
atggaagatttgacaaaccctgaggatatccgcacaaacatcaagtgtgaccggaaggtg
tctctttatggttatttacgaggagcctacctgaagactaacagccagatccacatgcca
ggtgtaggagattttgtcgccagcgatgtcagttttctcccagacccctgtgcccttccg
gaacagcaaaagaagcgctgtttgaatgagaaggaaaagctggtttatgcacctctctct
ggggttgggggtgtgctctatgacaaagatgctgtctatgttgacctgggtggcagccat
ggcttccagacagtggaggaagcaggccctacacatgaactggtccagagcctcatctcc
acccatgccagtatcgatgctaagatggcttcaagcagagtgacacttttctctgactcc
agacctctggggtcagaagacgtcgacagtcaagggctgtggatgccaaaggaggaaaag
caggtggacgtggaaacgggccgagtgcgtcggaaagccgtttttggagacacggaagaa
gagtctggagatgacgatagtgaaggagatgaagatgaaatgtcggacgatgacgggatg
gaaaatggctctagtgatgatgaggtggaagaggaagaaggtgctaaaagcagcagctgt
aaatacacaactgttaggggacacaaacgaccaaaacttgaggagcaggaagaagacagt
gaggcagatttgccggcgtttgctgatagcgatgatgatcttgagagaagctctggggga
gaggaggaggcagaggaagcagatgaaagcagtgctgacggtgcctccacaggagagagg
gacactggggaagccagctctgttggaggagctcgtggggcaagaccgccagcagctcac
cagtgggggccccatccggatggacagaagccttccccagtgagaaaagcagccctcacc
acttctgattctggtcactgtacagccgaagaggcatttccatctgaagatgagtctgag
gaatctgaactcagttcagaggaagaagactcagaacacaaagaggttgggggaacaaat
cctcagcagcacagaggacagaaacccgagtcagagaacgtgggtgatgagaccagcgac
attgaaaatttactcaaagaggaagaagatcacaaggaggaaaatagcagctctgtagaa
acgtcaggtgccctcaagtggaaggaagacctctccaggaaagcagcggaagcgtttctg
aggcagcagcaagcagctccgaatcttcgaaagctgatttatgggacagtgacagaggat
aatgaagatgaggatggcgatgcctcagaagagctcggagggctgttccgtgtcagccag
ccagataaagggtgtaagcacaaggctgactctctcgactgctccagatttcatgtggag
gcacctcatgattgggatttagaggaggttatgaacagcatcagagattgctttgtgact
gggaaatgggaagatgataaagatgcagccaagctcttagcagaagacgaagagctctat
ggtgactttgaagacctagaaacgggggacgtgcacaagggaaaaccgggcctggatact
cagagtgaagacatagaagaagaagaggaagtgaaggaagaaactggcccagctgaggag
gagagtgctagggaaaagcatctgaacaagaagagaaagctgaaggagctgtttgatgca
gagtacgatgaaggagaaagcacgtactttgatgatcttaagggtgagatgcagagacaa
gcacagcttaaccaggctgaatttgaagatcaagatgatgaaaccagagttcagtatgaa
gggtttcggcctggcatgtatgtccggattgagattgaaaacatcccctgtgaatttgtg
cagaactttgacccacactacccgattattctgggtggtttgggcaacagtgagggcact
gtgggatatgtgcagatgcgcctcaagaaacatcgctggtataagaaaatcctcaagtct
cgagacccagttattttctctgtgggatggaggaggtttcagactatcccactgtattat
atcgaagaccacaatggaagacagaggcttctgaaatacaccccgcagcacatgcattgt
ggagcaactttttggggtcctatcaccccacaaggaactgggtttttggcgatacagtct
gtcagtggcgcaatgcctgagtttcggatcgctgccactggagttgtccttgatctggat
aaatccataaaaatcgtgaaaaaattaaagctaactggttttccttttaaaatattcaag
aatacttcatttattaagggaatgtttaattctgcgttggaagtagccaaatttgaaggt
gctgtcattcgaactgtcagtggaataaggggacagatcaagaaagcactccgggctcca
gaaggggccttccgcgctagctttgaggacaagttgctaatgagtgatattgttttcatg
cgaacttggtatcctgtctccattccggccttctataatccagtaacatctttgttgaag
ccagtgggtgagaaagacacctggtcaggaatgcggacaacgcatcagctgaggcttgcc
catggaatcaaattaaagccaaacaaggattcattgtataagccaatcctgaggcaaaag
aaacattttaattcactgcacattcccaaagccttgcagaaggctctgccatttaagaat
aaacccaagacccaagcaaaggctggcaaagtgccaagggacaggcagagaccggcggtc
atacgtgaacctcatgagaggaaggtcttggctctgctagatgctctgagcacaatacac
ggtcagaaaatgaagaaggccaaagagcagagacacctgcacaacaaggagcatgtgaag
atgaagcagaaggaggaggaggagaagctgaggcggcagaaggacctgaggaagaagctc
ttccggatccagggtcagaaggaaaaacgaagtcagaagtctagtctaagaggagccgag
gccacctga

DBGET integrated database retrieval system