KEGG   Rattus norvegicus (rat): 362587
Entry
362587            CDS       T01003                                 

Gene name
Macf1
Definition
(RefSeq) microtubule-actin crosslinking factor 1
  KO
K19827  microtuble-actin crosslinking factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     362587 (Macf1)
SSDB
Motif
Pfam: Spectrin Plectin CH GAS2 Spectrin_like SH3_10 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 CAMSAP_CH
Other DBs
NCBI-GeneID: 362587
NCBI-ProteinID: NP_001129230
RGD: 1306057
Ensembl: ENSRNOG00000016047
UniProt: A0A0G2JWA8
Position
5q36
AA seq 7351 aa
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIRQHTILMSDKSFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIKELYKLLEVWIEFGRIKLPQGYHPNHVEEEWGKLIVEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDEKYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTTHLKAEPLNKTTHSSSTSWFRKPMTRTELVAISSSEDEGSLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQWETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYVETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSKATAELIWLNGKEEEELACDWSDSNPNISAKKA
YFSELTMELEGKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HIKENAAYFQFFSDARDLESFLRNLQDSIKRKYTCDHNTSLSRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKTIVQLKPRNPDHVLKSTLSVKAICDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCLLIPPPNTEAIDVASRVEQSYQKVMALWHQLHINTKSLISW
NYLRKDIDAVQTWNLEKLRSSAPGECHQVMKNLQAHYEDFLQDSHDSALFSVADRLRIEE
EVEACKTHFQQLMESMENEDKEETLAKVYISELKNIRLRLEECEQRLLKQIQSSASSKTD
RDARQDVALRIAEQEHVQEDLKHLRSDLDAVSVKCTTFLQQSPSGSSATTLRSELNLMVE
KMDHVYGLSIVCLNKLKTIDVIVRSIQDAELLVKGYEIKLSQEEAVPADLSALESHRTTL
QHWLSDVKDKNSVFSVLDEEISKAKAVAEQLHHRAAEPNLDLERYQEKGSQLQERWHRVI
AQLETRQSEVESIQEVLRDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQT
ELFAEIERNQTKLDQCQKLSQQYSTTVKDYELQLMTYKAFVESQQKSPGKRRRMISSSDA
ITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKDLLGWVST
LARNTQGTTTSSRTSASTDIEKAILEQQVLAEELTTKKEQVSEAIKTSQIFLAKHGHKLS
EREKEQISEQLCALNKTYHDLCDGSANQLQQLQSELAQQTEQKGCRAVAGVIDLGTVEIF
PIFRAMQKGLIDQDTGLVLLESQVIMSGLIAPENSEKLSLEEGLTRNLISLPMYQHLLGL
RDSLSLISSLTGTQGSLSVVEAIEKKIVSERFGLKVLEVHLATGGFSLPPSENYINLEEA
FHQGFIASWLHSELQSHLRTSKNLIDPNTAEKVGLLELMQRCISHQESGLKLLPVKQLAG
GMVSLKSGGKVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTAEEAVRHNLI
DQDMACAILIRQLQTGGIIDTATGERMTIDEAVTNNLVAAKIALVILESLWSFMGLLLPE
SGEILPITDALEQGIVSNELAHKILHNRQQIEALFLPTITEVWSWEKATESGILDKDLAN
NLRSVCIPDMRPHIQLADSAEQSKVGVAAGKPPLSCQREGRTSREEKLLFQLMTHSYINA
HTGQRLLLLDQELVEMLTSRDEYQVGLPEVFEIQPQRLDTSKDLQELDPGTISQISSARK
PCESQFPSQSKGYPSQENCTQAKGERSVIGRECSSAESPERELFVGEQGAITENVGSLKV
INKVKLELQSPLLGSRKEEQTEMFSEENVSSDPLLVECPEGSEDMSLVLDKDLSTEKSKC
QAPTKSSFTRHKEQVKTVKADHIPSETGIPLTKSQNKTSQVQVDASVSLKSEFKSEYDEK
ELNETLLVKGSHKQSQEGQSVPDGQMVVLEKADTEDNGDEPSLLCSSPFEDATLSTLSAQ
LQDGGIFHEETGQKLLLNEAIAQGLVSSHTAVKLMGKLNMFRGFFDSQTCESLTTEEVID
EGLMDEKLLCNVLMSDKAISGILDPRTHSLCSVQEAVAAGLLDKETATRILEGQVITGGI
VDLKRGKRLSVTLASNLGLVDTTDQTELINLEKATKGRGAEKAVKERLIGLQMETTGLLD
PESKAPLTVLQSIDRGLIEREEAIYQLTKQVLDGGIIHHISGLRLSVDNAFKHGMIGEDV
ARQLRKVENFNHHQFFHPQTKEALSFSEAIKLDLVSPDLKREIQEILDFSENLGDLIYGQ
KLTSVKANKEESLANKTALPSRVIHGVIDPESCTTIPYSELVKKCRIDIESGWRYLEVIP
LSDIKDEMSNKVLTPSEAIQRGKVDFGSMLKVLEAQANTGGIIDMATGKRVTLASALEQK
LIDENMARIIASHQVLTGGIIDIYNDQRVTLNDAVEKRLISPELATMIQADTLGKQGGTG
VCELKGEFLRNEFRKATRESYDKEKHEGVLQVGSQCAQEKANVRVSYGVKVGKGKKISVE
MEGQRQDEEKASSDNEVSASIVSPGGLEGESTHQVLVTHPCSGSSDLKLIEEARSPEVEQ
EEAVARMKMTPHVNRSTPGLDAGEARDCPGRVGSKGQESKHEPAGKLSSVQAANVEVGRR
GRRETGGEERVQTNKVAAGPSEEELDQEVTIGDEHGSFVKSQPMKTIGNDRGKEGGREKD
FSLVCKTEGFPSQMTFKDASLENQNALMFFSEGETKTVNLCSILKQREKLSQETASIVQK
EPFSSEIPRPERLNSQESDGESHISDMPCISKGPMAAQITTRQETTDEQDLSITSKTAET
KDRIFPSKNYKEKLLQEIPMDSTRAHKLKESTVSTLDTEGLGYLDSSDIKALHEDSRADR
EFSGHQKSKITTTQEVKFLEVVNPLVRDAEGHRGSSKDRVAQRGPRTLASLLPEKLPAGT
AQSENTKQHDTVIIATTPEMREEMPLSLPCSPLKVDEQIPKEKHKELPGDERASCMATPS
GKGSEGVKPAPCRATQNVFTRRLCLEHDEKLVSYLSLLRDIEMRTKQIQPLELSVAELQD
LLGQAKVLDRELKDLSTVVSQELECVDQIVISQPQEVPAQLLKALEKDAKNLQKSLGSVR
DSWSSRSLHLHNAVEVKKTTVLNWHKELEGKLQDLKAWVDRTSLTLHSKGCDTQTDADSL
SPTLQGYEDMKQSVAERKSQLDALALDTQLFISEHPQGLSLQQNQQMLQFLSELQTSFQG
LVEHTAAQKDVVQGHLQQVQQEVQVKTLQKQQDTCHKKLEDLRSWVRQAERALERHRGRA
SQQELSALQQNQSDLKDLQGDIQNHSTSFATAVKDIEGFLEENQNKLSPQELTALREKLY
QAKEQYEGLQDRTREAQKELEEAVTSALQQETEKSKAATELAENRRKIDALLDWVTSVGS
SDRQPQTSLPGTEQFSGACLEKQTLDATDGCVDVNQVPEKLDRQYELMKARHQELLSQQQ
NFIVATQSAQSFLDQHSHNLTPEERQMLQEKLGELKEQYAASLAQSEAKLRQTQTLRDEL
QKFLQDHREFENWLERSENELDGMHTGGSSPEALNSLLKRQGSFSEDVISHKGDLRFVTI
SGQKVLETENNFEEGQEPSPTRNLVNEKLKDATERYTTLHSKCTRLGSHLNMLLGQYQQF
QSSADSLQAWMLTCEASVEKLLSDTVASDPGILQQQLATTKQLQEELAEHQVPVEKLQKA
AHDLMDIEGEPSLDCTPIRETTESIFSRFQSLSCSLAERSALLQKAIAQSQSVQESMESL
LQSMKEVEQNLEGEQVAALSSGLIQEALANNMKLKQDIARQKSSLEATREMVTRFMETAD
GNSAAVLQDRLAELSQRFHRLQLQQQEKESGLKKLLPQAETFEQLSSKLQQFVEHKNRLL
ASGNQPDQDIAHFSQHIQELTLEMEDQKENLGTLEHLVTALGSCGFALDLSQHQEKIQNL
KKDFTELQKTVQEREKDASNCQEQLDEFRKLIRTFQKWLKETEGNVPPAETFVSAKELEK
QIEHLKGLLDDWAGKGVLVEEINTKGTALESLIMDITAPDSQAKTGSVLPSVGSSVGSVN
GYHTCKDLTEIQCDMSDVNSKYDKLGDALRERQESLQTVLSRMEEVQKEASSVLQWLESK
EEVLKGMDASLSPTKTETVKAQAESNKAFLAELEQNSPKIQKVKEALAGLLEAYPNSQEA
ENWRKMQEDLNSRWEKATEVTVARQKQLEESASHLACFQAAESQLRPWLMEKELMMGVLG
PLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLTEAAQGILTGPGDVSPSASQVHKDLQS
ISQKWVELTDKLNSRSTQIDQAIVKSTQYQDLLQDLSEKVKAVGQRLSGQSAISTQPDAV
KQQLEETSEIRSDLGQLDDEMKEAQTLCQELSLLIGEQYLKDELKKRLETVALPLQGLED
LAADRMNRLQAALASTQQFQQMFDELRTWLDEKQSQQAKNCPISAKLERLQSQLQENEEF
QKNLNQHSGSYEVIVAEGESLLLSVPPGEEKKTLQNQLVELKSHWEDLNKKTVDRQSRLK
DCMQKAQKYQWHVEDLVPWIKDCKSKMSELQVTLDPVQLESSLLRSKAMLNEAEKRRSLL
EILNSAADILINSSEIDEDEIRDEKAGLNQNMDAITEELQAKTGSLEEMTQRLKEFQESF
KNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLKAQREVLQALDPQVDYLRDFTRGLVED
APDGSDASPLVHQAELAQQEFLEVKQRVNSSCLTMENKLEGIGQFHCRVREMFSQLADLD
DELDGMGAIGRDTDSLQSQIEDIRLFLNKIQALRLDIEDSEAECRKMLEEEGTLDLLGLK
RELEALNKQCGKLTERGKARQEQLELTLGRVEDFYSKLKALNDAATAAEEGEALQWIVGT
EVDVINQQLADFKMFQKEQVDPLQVKLQQVNGLGQGLIQSAGKTCDVQGLEHDMEEVNTR
WNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLTDTEELIANQKPPSAEYKVVKAQI
QEQKLLQRLLDDRKATVDMLQAEGGRIAQAAELADREKITGQLESLECRWTELLSKAAAR
QKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAKIHQQIIRHKALNEEII
NRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLA
TKFHSTYEELTGWLREVEEELAASGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNE
VSHALLELVPWRAREGLDKLVSDANEQYKLVSDTVGQRVDEIDAAIQRSQQYEQAADAEL
AWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFSTCGE
EQKAVLQEKTECLIQQYEAVSLLNSERYARLERAQVLVNQFWETYEELSPWAEETLALIA
QLPPPAVDHEQLRQQQEEMRQLRESIAEHKPHIDKILKIGPQLKELNPEEGKMVEEKYQK
AENMYAQIKDEVRQRALALDEAVSQSAQFHDKIEPMLETLENLSSRLRMPPLIPAEVDKI
RECISDNKSATMELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWED
IKARSEEREIKFLDVLELAEKFWYDMAALLTTIKDTQEIVHDLESPGIDPSIIKQQVEAA
ETIKEETDGLHEELEFIRILGADLIFACGETEKPEVKKSIDEMNNAWENLNRTWKERLEK
LEDAMQAAVQYQDTLQAMFDWLDNTVIRLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQ
IEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQ
FQHALEELMGWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAG
NELLESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQSTLQQAQGFHSEIEEFLLE
LNRMESQLSASKPTGGLPETAREQLDAHMELHSQLRAKEEIYNQLLDKGRLMLLSRGDSG
SGSKTEQSVALLEQKWHVVSSKVEERKSKLEEALSLATEFQNSLQEFINWLTLAEQSLNI
ASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVS
VQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKI
KLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLADDAQKLDNLLGEVRDKWDTVCG
KSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVF
QKELGKRTGTVQVLKRSGRELIESSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQA
LKQAEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKKVEEKRVDVN
AAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELL
EELLAWIQWAETTLIQRDQEPIPQNIDRVKALITEHQSFMEEMTRKQPDVDRVTKTYKRK
NIEPTHAPFIEKSRSGSRKSLNQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQ
RKLNDALDRLEELCPELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITR
QEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIE
DEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMA
LDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSS
ASQSNHSCTSMPSSPATPASGTKVISSTGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTG
AKTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQG
SSRRGLTKPSKIPTMSKKTTTASPRTPCPKR
NT seq 22056 nt   +upstreamnt  +downstreamnt
atgtcttcctctgatgaagaaacgctcagtgagcgatcctgtcggagtgagaggtcatgt
cgtagcgagagatcgtacaggagtgagcggtcagggagcctgtctccctgtccccctggg
gacaccttgccctggaacctgccactgcatgagcagaagaagcggaaaagccaggattct
gtgctggaccctgcagaacgcgccgtggtcagagttgctgatgagcgggaccgggtgcaa
aagaaaacattcaccaagtgggtcaacaagcacttgatgaaggtccgcaagcacatcaat
gatctctatgaagaccttcgggatggacacaacctgatctctctgttagaggtcctctcg
ggcatcaaactgcccagagaaaagggcaggatgcgttttcacaggctgcagaatgtgcag
attgccctggacttcctaaagcagcggcaggtgaagctagtgaacatccgcaatgatgac
atcacggacggcaatcccaagctcaccctgggcctcatctggaccatcatcttgcacttc
cagatctctgacatctatattagtggggagtcaggggatatgtcagccaaagagaagcta
ctcttgtggactcagaaagtaacagctggttacacaggaatcaagtgcaccaacttttct
tcctgctggagcgatgggaaaatgttcaatgcattgattcaccgatacagacctgacctg
gtagatatggagagagtacaaatccagagtaaccgggagaatctggaacaggctttcgag
gtagctgagagacttggtgtcacccgattgctggacgcagaagatgtggatgtgccatct
ccagatgaaaagtctgtaatcacttacgtgtcttccatttacgatgccttccccaaagtc
cctgagggaggagaaggaatcagtgctacggaagtggactccagatggcaagaataccaa
agccgagtggactcactcattccctggatcaggcagcatacaatcttgatgtcagataaa
tcttttccccagaaccctgttgaactaaaggcactttataaccaatatatacacttcaaa
gaaacggaaattctggccaaggagagagaaaaaggaagaatcaaagagttatataagtta
ttagaggtgtggattgaatttggcagaattaagctgcctcaaggctaccaccctaatcat
gtagaagaagaatgggggaaactcatcgttgaaatgctagagcgagagaaatccctgcgg
ccggctgtggagaggctagaattgctgctgcagattgcaaacaaaatacagaatggtgct
ttgaactgtgaagaaaaactgacactagctaagaatacactgcaggctgatgctgcacac
ctggagtcaggacagccagtgcagtgtgagtcagatgtcatcatgtacattcaggagtgt
gagggtctcatcaggcagctgcaggtggatctccagatcctacgggatgaaaagtactat
cagttagaggagctggccttcagggtcatgcgtctgcaggatgaactggtcaccctgcgc
ttagagtgtaccaatctataccggaaaggccatttcacatcacttgaattggttccgccc
tctactttaaccactactcatctgaaagcagaacctctgaacaagacgactcattcttct
tctacctcctggtttcgaaaacctatgacccggactgagcttgtagccatctcatcctct
gaagacgagggcagtctccgattcgtatatgaactactctcttgggtagaagagatgcag
atgaaactggagcgagcagagtggggaaatgacctgcccagcgtggagctgcagtgggaa
acacagcagcacatccacaccagtgtggaagagctgggctcaagcgtcaaggaggccagg
ctgtacgagggaaagatgtcccagaatttccataccagctatgtggagactcttggaaag
ttggagacacagtattgtaagttgaaggagacttctagcttccgaatgaggcaccttcag
agcctacacaaatttgtttccaaagccacagctgaactgatctggctgaatgggaaggag
gaagaagagctagcatgtgattggagtgacagtaatcccaatatctcagccaagaaagcc
tacttctctgagttgacaatggagctggaagggaaacaagatgtatttcgttctctacaa
gatacagcagaactgttgtcacttgagaaccaccctgctaagcaaactgtggaggcatat
agtgctgccgtccagtcccagttgcagtggatgaagcagctgtgcctatgtgttgaacaa
catataaaagagaatgcagcttacttccagttcttcagcgatgctcgagacctggagtca
tttctgagaaacctacaagactccatcaaacgaaaatatacctgcgaccacaacaccagt
ctgtcccgccttgaggatctgctacaggactccatggatgaaaaggagcagcttatacag
tccaagagttccgttgccagtcttgttgggagatcaaaaaccattgttcagctaaagcca
cgcaatccagaccatgtgttgaagagcactttatctgtgaaggccatctgtgactaccga
cagattgagatcactatttgcaaaaatgatgaatgtgtgctggaagataattctcagcgg
accaaatggaaggtgatcagtcctacagggaacgaggccatggtgccgtcagtctgcctg
ctcattcccccaccaaatacggaggccattgacgtggccagcagggtggaacagtcttac
cagaaggtgatggccctttggcaccagctacacattaacaccaaaagccttatctcctgg
aactacttgcggaaggatattgatgccgtacagacctggaacttagaaaagcttcgttcc
tcagccccaggagagtgccatcaggttatgaagaacctccaggcacactatgaagacttt
ctccaggacagtcatgactctgctctcttttctgtggccgatcgcttgcgaatagaggag
gaggtggaagcttgtaaaacccacttccagcagctgatggaatcaatggagaatgaggac
aaagaagagactttggcaaaggtatacatctcagagctgaagaatatccgacttcgcctg
gaggaatgtgagcagaggctgctcaaacaaattcagtcttcagccagctctaagactgac
agagatgccaggcaggacgtcgcattgaggattgcagagcaggagcacgtgcaggaggat
ttgaagcatttgagatctgacctggatgctgtttctgtgaaatgcaccacctttctccag
cagtctccatcaggctcgagtgccacaactctgcgctccgagctgaacctaatggtcgag
aagatggaccatgtctatggtctgtctattgtctgtctgaataagttaaagacaattgat
gttatagtacgcagcatacaggatgctgaactgttggtcaaaggttatgagatcaagctg
agtcaagaagaagcggtgccagcagacctctcagctctggagtcccatcgaaccacatta
cagcactggcttagtgatgtgaaagacaagaattcagtattctcagtcctggatgaggaa
atctctaaggccaaggcagtggcagaacagctccatcaccgagcagcagagccgaacttg
gatttggagcgttatcaggagaaaggctcgcagcttcaggagcgatggcaccgtgtcatt
gcccagctggagacccggcagtcggaggtagaaagtatccaggaagttctgagagattac
cgagcctgccatgggactctcatcaagtggattgaggaaaccactgcccagcaggaaatg
atgaagccgggccaggcagaggatagcagagtgctgtctgagcagcttagtcagcagacg
gaactgtttgctgagattgagagaaatcagacaaaactggaccaatgtcaaaaactttcc
cagcagtactccactactgtaaaggactatgagttgcagcttatgacgtacaaggccttc
gtggagtcacagcagaaatctccgggcaagcgccgtcgcatgatttcctcttcagatgcc
atcacacaggagttcatggacttgaggactcgatacacagctttggtgacattaacgact
cagcatgtaaaatatatcagtgatgctctccggcggttggaagaagaagagaaagtggta
gaagaggaaaaacaagaacatgtggagaaggttaaagaccttttgggttgggtgtctact
ctggcgagaaatacacaaggaacaactacctcatctcgcactagtgcatccacagacatt
gagaaggccattttggaacagcaggttctggcagaagagctgacaaccaagaaagaacaa
gtttctgaggccattaaaacgtcacaaatcttcttagccaagcatggtcataagctttca
gaaagagagaaggaacagatctctgagcagttgtgtgccttgaacaagacttaccatgat
ctttgtgatggttctgcaaaccaactccagcagctccagagcgagctggctcagcagaca
gaacaaaagggttgcagagcagttgctggggtgattgacctaggcacagtggagatattc
cccatcttcagagccatgcaaaagggcctcattgaccaagacacaggccttgtgctcctg
gaatcccaggttatcatgtctggcctcattgctcctgagaacagtgaaaagctctctttg
gaagagggcctcaccagaaatctcattagccttccaatgtaccaacacctcctaggacta
agggattctctgtctttaataagtagtcttacagggacccaaggctccctttctgtggtg
gaagcaattgaaaagaaaatagtcagtgagagatttggactgaaagtcttagaagttcac
ctggcaactggaggtttcagtctcccaccaagtgagaactatattaatctggaagaagct
tttcatcaaggcttcattgcatcatggcttcattcagaattacagtctcacctgagaaca
tccaagaatttgatagaccccaacacagccgaaaaagttggcttgctggaactgatgcag
cgatgtatcagccatcaagagtcagggttaaaattgttgcctgtcaagcagttggcaggg
ggaatggttagcttgaaatcaggtgggaaagttagcattttccgtgctgttcaggaaggg
ctgatagataggcaggtcactgtccggttactggaagctcagctgtttgctggtggcata
gtggatccaagaacaggacacagacttacagcggaagaggctgtgagacataatttgatt
gaccaagatatggcctgtgctattcttataaggcagcttcagacaggaggcatcattgac
accgccacaggagaaagaatgactattgacgaagcagtgaccaataatctagtagctgct
aagattgctcttgtaattctggaatccctctggtcatttatggggttactgttgcctgaa
tctggagagatcctcccaattacagatgctctagaacaaggtattgtgtctaatgaatta
gcacataaaatcctccataaccgacagcaaattgaggctctttttctaccaacaatcaca
gaggtttggtcctgggaaaaagcaacagagagtggtatcctagataaagatcttgccaat
aacttaaggtcagtctgtatccctgacatgaggccccacatacaactagcagactctgca
gagcaaagcaaagtaggcgttgctgctgggaaaccacctctgtcgtgccaaagagaggga
agaaccagccgtgaagagaagctgctgtttcagctgatgactcacagctacattaatgca
cacactggacagaggctgcttctactggatcaagagctggtggagatgctaacatccaga
gatgagtatcaagtaggtcttccagaagtatttgaaattcagcctcaaagactcgacact
tctaaggatttacaagaattggatcctgggactatctcccaaatttccagtgctaggaag
ccctgtgaatcccagtttccttctcagagcaagggctatcccagtcaggaaaactgtact
caagcaaaaggtgagaggtctgtcataggaagagagtgctcttctgcagagagtcctgaa
agggagctgtttgtgggagaacaaggagccattactgaaaatgttggcagtttgaaggtc
atcaataaagtcaaattagagctacaaagtccattgttaggaagtagaaaggaagagcaa
acagaaatgtttagcgaggaaaatgtcagcagtgatcccctccttgtagaatgtcctgag
ggatctgaagatatgtccttggtgcttgacaaggacctttctactgagaagtcaaaatgc
caagctcccacaaagtcttcatttacacgtcacaaagaacaagtgaagactgtcaaagct
gaccatattccaagtgaaactggaataccactcacaaagtctcaaaataaaacttcacaa
gttcaggtagatgcttctgtaagtttgaaatcagaatttaagtcagaatacgatgagaaa
gagttaaatgaaacacttttggttaagggtagccacaaacaaagccaagaaggacagagt
gttccagatggtcagatggtggttttagaaaaggctgatacagaagataatggtgatgag
ccttccttgttgtgtagttctccttttgaagatgctaccttaagtacattatctgcacag
ctacaggatggtggtatctttcatgaagaaacaggtcagaaactcttactaaatgaagca
atagcccaaggccttgtgtctagccatactgctgtgaaacttatggggaaattgaacatg
tttcggggcttcttcgactcccagacatgtgaatctttgacaactgaagaagtcattgac
gaaggtctaatggacgagaaattattatgtaatgtccttatgtcagacaaagctataagt
ggtatcttagaccctaggacccactcactgtgctctgtacaggaggctgtagcagctgga
cttcttgacaaggagacagccacaagaattttagagggacaggtgataactggtggaatt
gttgacctgaaacgaggcaaaaggctttcagtaactttggcctcaaatcttggtttggta
gacactactgaccagacagaacttatcaatctggaaaaggctaccaaaggcagaggtgct
gaaaaggcggttaaagagagattaattgggctacagatggaaacaacaggacttctggac
cctgaaagtaaagcaccattaacagtcttgcagtccattgatagaggtcttatagagaga
gaagaagctatttatcagttgactaagcaagtacttgatggtggtatcattcatcatata
tctggcttgagactctctgttgataatgcctttaaacatggcatgattggtgaagatgta
gccaggcagctcagaaaagttgagaactttaaccaccatcaattttttcatcctcaaaca
aaggaagctctttccttctcagaagccataaaattagatcttgtttctccagacttgaaa
agagaaatccaagagattctggactttagtgaaaacttgggggatctcatttatggccag
aaattgacctcggtaaaagctaacaaagaagaatccttagctaataaaacagcattgcct
tcgagagtgatacatggggttatagatcctgagagctgcacaacaattccctactcagaa
ttggtaaagaaatgtaggattgacattgaatctggatggagatatctcgaagtaattcca
ctctctgatattaaagatgagatgagcaacaaagtgctaacaccatctgaagcaattcag
cgtggaaaagtagactttgggtctatgttgaaggttttggaagctcaggcgaacactggt
ggaatcatagatatggccacaggaaaaagagtgacattggcatcagctttagaacagaaa
ctcatagatgaaaacatggccaggattattgcatcccatcaagtgttaactggaggaatt
attgatatatataatgatcaaagagtgactttaaatgatgctgttgagaaaaggttgatt
agccctgaactggcaactatgatccaagcagataccttaggaaagcaaggtgggactgga
gtatgtgaattaaagggtgaatttctaagaaatgagtttaggaaggccaccagggagagt
tatgataaagagaaacatgagggagtgttacaagttggaagtcagtgtgctcaagaaaag
gctaacgtaagggtttcttatggggtaaaggtaggaaagggcaagaagatttcagtagag
atggaaggccagcgtcaagacgaggagaaggcttcttcagacaatgaagtatctgccagc
atcgtaagtcctggtggtcttgagggtgaatctacacaccaagttttggtgacgcatccc
tgctcaggatcttctgatttgaaactcatagaggaagccaggagtccagaggtagagcag
gaggaagcagtagcacgaatgaagatgactcctcacgtaaatcggtcaaccccaggcctg
gatgctggagaagcaagagactgtccagggagagtgggttcgaaaggacaagaatctaag
catgaaccagcaggcaaactgtcgagtgtgcaggcagcgaatgtggaagttggtaggaga
ggaaggagagagacgggtggagaggaaagagtccaaacaaacaaagtggcagcaggtcct
tctgaggaagagttggaccaggaagttacaattggtgacgaacatggctcctttgtaaag
agccagcctatgaagacaattggaaatgacaggggaaaagaaggtggtagagaaaaggac
ttttctcttgtttgtaaaaccgaaggcttcccttcccagatgacattcaaagatgcttcc
ctagaaaatcaaaatgctttgatgttcttcagcgaaggggaaacgaaaactgtcaacctc
tgctcgattttaaaacaaagagaaaagttatctcaagaaactgctagtattgtccagaag
gaaccattctcttctgagattccaagacctgaaagactgaactcccaggaatcagatgga
gaatcccatatttctgacatgccctgcatttccaaaggtcccatggctgcccaaattacc
acaagacaggagactactgatgaacaagacctgagtattacatctaagactgcagagacc
aaagataggattttcccatccaaaaattataaagaaaagttacttcaagaaatacctatg
gactcaacaagagcccataaactgaaagaaagcacagtttccactctagacacggaagga
ctcggttatctagattcctcagatataaaggctcttcatgaggatagcagagcagatcgt
gagtttagtggacatcagaaatcaaaaataacaacaacccaggaagtaaaatttctagaa
gtggtaaatcccctagttagagacgcagaaggtcacagagggtcctctaaggacagagtg
gctcaaagaggacccagaaccttggcatctcttcttccggagaaactgcccgcagggaca
gcacagagtgagaatacaaagcagcatgacacagtcattattgccaccactcccgaaatg
agggaggagatgccactgtccctgccatgttctccattgaaggtggatgagcagatacct
aaggagaagcacaaagagctccctggagatgagcgagcctcctgcatggctacacctagt
gggaaggggagtgagggtgtaaagccagcaccttgcagagcaactcagaatgtgtttacc
cggagactttgtttagaacatgatgagaaattggtctcctatctgtccctgttacgggac
attgaaatgagaaccaaacagattcaacctttggaacttagtgtggcagagctgcaagat
ctgctgggtcaggccaaggtattagacagggaattaaaagatctgtctaccgtggtaagt
caggaattggaatgtgtggatcagattgttatcagtcagccacaagaagttcctgctcag
ctgttgaaggcgttagagaaggatgccaagaatcttcagaagtctctaggctctgttcgt
gactcctggagctccagatccctccatctgcacaatgcagtggaagtgaaaaagaccaca
gtgttaaattggcacaaggagctagaaggcaaacttcaagatctgaaagcctgggttgac
agaaccagtcttactctgcatagcaagggatgtgacactcaaactgatgctgacagcctg
agtcccactctccagggatatgaggatatgaaacagtctgtagccgaaaggaagtctcag
ctggatgccctggctttggatactcagctctttatttctgagcacccacagggcttgtct
cttcagcagaatcagcaaatgctgcagtttctgagtgaattacagacgtctttccagggc
cttgtggaacacactgcagctcagaaggatgtggtgcagggccatctccagcaagtccag
caagaagttcaggtcaagactctgcagaagcaacaagacacgtgtcataagaagctggag
gatctccgcagctgggtcagacaggcagaaagggcactggagaggcaccggggcagggcc
tctcaacaagagctttctgctctgcagcagaaccaaagtgacttgaaggatttgcaaggt
gacattcagaatcactccacctcatttgccactgctgtcaaagacattgaagggttccta
gaagagaaccagaacaagctgagccctcaggagctgacagctcttcgagaaaaactttat
caagcaaaggagcaatatgagggtctccaggatcgcacacgggaggctcagaaggagctg
gaggaagcagtgacgtcagccttacagcaggagacagagaagagtaaagcagcgacagag
ctggcagagaacagaaggaagatcgacgctctcttggactgggtgacttctgtggggtca
tctgatagacagccacagactagccttccaggaacggagcagttctctggagcttgcctg
gaaaaacaaaccttagatgcaacagatggttgtgtggatgtaaaccaagtaccagagaaa
ctggacaggcagtatgagttaatgaaggcacgtcaccaagaattgctgtctcagcagcag
aatttcattgtggctacccagtcagctcagtccttcctggaccaacacagtcacaatctt
acacctgaggagcgacagatgcttcaggagaagctaggtgagcttaaggagcaatatgca
gcttccctggcccagtcagaggcaaagctgaggcagacgcagactctacgagatgaactg
cagaagttcctgcaagaccacagggaatttgaaaactggctagaacgatctgagaatgaa
ctggatggtatgcatacgggaggcagcagccctgaagctctgaactccttgcttaagcgg
caaggaagcttctcagaggatgtcatttcccacaaaggagacttgagatttgtgactatc
tcaggacagaaagtcttagaaacagaaaacaattttgaggaaggccaggagccgtcaccc
accagaaacttagtgaatgaaaaactgaaggatgcaacagaaagatacaccactctccat
tctaagtgtacacgattgggctctcacctgaacatgctgctaggccagtatcagcaattc
cagagcagcgctgacagcctgcaggcctggatgttgacttgtgaggccagtgtggagaag
ctcctctcagatactgttgcctctgaccccgggatccttcagcaacagctcgcaaccaca
aagcagttacaggaagaattggctgaacaccaagtacctgtagaaaagcttcaaaaagca
gctcatgacctaatggacattgaaggagagccatccctggactgtacgcctattcgagaa
actacagagtccatattcagccgcttccagagcctctcttgtagcttagctgagcggtct
gctttgctgcagaaggcaattgctcagtctcagagtgttcaggaaagtatggagagcctc
ctgcagtccatgaaggaagttgagcaaaacctggaaggggagcaggtggcagcactctca
tcaggactcatccaagaggccttggccaacaacatgaaactaaagcaagacattgctagg
caaaaaagcagcttggaagccacccgtgagatggtcactcgattcatggagaccgctgac
ggcaactcggccgcagtgctgcaggacagactggcagagctgagccagcgattccatcgg
ctgcagctccagcagcaagaaaaggaaagcggcctgaagaagctcctgccccaggccgag
acattcgagcagctctccagcaagctgcagcagttcgtggaacacaaaaaccgactgctg
gcctcagggaaccagccagatcaagacattgcacatttctcccagcacatccaggaactc
acattggaaatggaagaccaaaaggaaaacctaggtactctcgagcacctagttactgcg
ctgggctcttgtggctttgcactggatctgtctcagcaccaagaaaagatacagaacctt
aagaaggattttacagagttgcagaagacagttcaagaaagagagaaagatgcatcaaat
tgccaggaacaattggatgaattccggaaactgattagaaccttccagaaatggctgaaa
gaaactgaaggaaacgttccacctgcagagactttcgtgagtgctaaggaattagagaag
cagattgaacacttgaagggtctcctagatgactgggcaggtaaaggagtgctggtggag
gagatcaacaccaagggcactgccttagaaagtctcatcatggacatcacagcgcctgat
tcccaggctaagacaggttccgtactaccctctgtaggaagctctgtaggcagtgtaaac
ggataccacacctgcaaagatcttacagagattcaatgtgacatgtctgatgtaaattcc
aagtatgataaactgggagacgcgctgcgggaacgccaggaaagccttcagactgtcctc
agcagaatggaggaggtccagaaggaggcgagctctgtattacagtggttagaatcaaaa
gaagaagttctgaaaggcatggatgcctctttgtctccaaccaagacagaaacagtaaaa
gcccaagcagaatctaataaggctttcctggctgaattggagcagaattcccccaaaatc
cagaaagtaaaggaagccctggctggattactggaagcatatcccaattcacaagaagca
gaaaactggaggaaaatgcaagaggacctcaattcccgatgggaaaaggccaccgaggtt
actgtggctcgccaaaagcagctagaggaatctgcaagccatctggcctgcttccaggct
gcagagtcccagctccgcccttggctgatggaaaaggagctgatgatgggagttcttggt
cccctgtctattgaccccaacatgttgaatgcccagaagcagcaggtccagtttatgctg
aaggaatttgaagcacgaaggcagcagcatgagcagctgactgaggcagctcagggcatc
ctcacgggtcctggagatgtgtctccctctgccagccaagtacacaaagatctgcaaagc
atcagtcagaagtgggttgagctcaccgacaagcttaactcccgttccacccaaattgac
caagctattgttaaaagtacccaataccaagacttgctccaggacttatcagaaaaggtg
aaggcagttggacagcgactgagtggccagtcagccatcagcacccaacctgatgctgtg
aagcagcagctagaggagaccagtgagattcggtctgacttgggacaactagacgatgag
atgaaggaggctcagacgctgtgccaagaactctcactgctcattggcgagcagtacctc
aaggatgagctgaagaaacgtttggagacagttgccctgccactccaaggcttagaagac
ctcgcagctgaccgcatgaacagactccaggcagctcttgccagcacccagcaattccag
caaatgtttgatgagctgaggacctggttagatgaaaaacaaagtcagcaagcaaaaaac
tgcccaatttctgcaaaattggaaaggctccagtctcagctacaagagaatgaagagttt
cagaagaaccttaatcagcacagtggttcctatgaggtgatcgtggctgagggggagtct
ctgctgctttctgtgccccctggagaagagaaaaagactttacaaaaccaactggttgaa
ctcaaaagccattgggaagatcttaataaaaaaactgtagacagacagtctaggctcaag
gactgtatgcagaaagctcagaagtatcagtggcatgtggaagaccttgtgccctggata
aaagattgcaagtccaagatgtctgagttgcaggttaccctggatccagtacaactagag
tctagcctcttaaggtcaaaggctatgctgaatgaggcagagaagcgccgctccctgctg
gaaatactgaatagtgctgctgacattcttatcaattcttcagaaattgatgaagatgag
atccgagatgagaaggctggactcaaccagaacatggatgccattactgaggagctgcag
gccaaaacaggctctctagaagaaatgactcagaggctcaaggagttccaggaaagcttt
aagaacattgaaaagaaagttgaaggagccaaacaccagcttgaaatctttgatgccttg
ggctctcaagcctgtagtaacaagaatctggagaagctaaaggctcagcgagaagtgctg
caggccttggaccctcaggtagactatctgcgggacttcactcggggactcgtagaggat
gccccagatggatctgatgcttccccactcgtgcaccaagctgagcttgcacagcaggag
ttcttagaagtgaagcaaagagtgaacagtagctgcctgaccatggagaacaagctagag
gggatcgggcagtttcactgtcgagtccgagaaatgttttctcaattggctgacctggat
gatgagctagatggcatgggagccattggtagagacacagatagcctccagtcacaaatt
gaggacatacggctattccttaacaaaatccaagccctcaggcttgacatagaggactct
gaagcagagtgtcgaaaaatgttggaggaagaggggactttagacttactgggtctcaag
agggagctagaagcccttaacaagcagtgtggtaaactgacagagcgagggaaagctcgc
caggagcagctagagctgacgctgggccgagtagaggacttctacagtaaactgaaagcg
ctcaatgatgctgccactgctgcagaggagggagaagctcttcagtggattgtggggact
gaagtcgatgtcatcaaccagcaactagcagatttcaaaatgtttcagaaagaacaagtg
gatcctcttcaggtgaaattgcagcaggtgaatggacttggccagggattaattcagagt
gcgggaaaaacctgtgatgtgcagggtttagaacatgacatggaagaggtcaatactcga
tggaatacactgaataaaaaggttgcacaaagaattgcacaactgcaggaggctttgtta
cattgtgggaaatttcaagatgccttagagccattgctcagctggttgacagacaccgag
gagctcatagccaatcagaagcctccatctgccgagtataaagtggtgaaagcccagatc
caagaacagaagttgctccagcgactcctagatgatcgcaaggccacagtggatatgctt
caagcagaaggaggcagaatagcccaggctgctgaactggctgatagagagaaaatcact
gggcagctggaaagccttgaatgtagatggactgagctcctcagcaaggcagcagccagg
caaaagcagctggaggatatcttggttctggctaaacaattccacgagacagctgagcct
atttctgacttcctatctgtcacagagaaaaagcttgctaactcggaacctgttggcact
caaactgccaaaatacaccagcagattattcgtcacaaggctttaaatgaagagattatt
aatagaaagaagaatgtagatcaagctattaaaaatggtcaggctcttctaaaacaaact
acaggtgaggaggtgttacttatccaggagaagctggatggaataaagacccgttatgca
gacatcactgtcactagctccaaggccctcagaactttagaacaagcccggcagctggcc
accaagttccattctacatatgaggaactgactgggtggctgagggaggtggaggaggag
ctggcggccagtggaggacagtctcccacaggggagcagataccccagtttcagcaaagg
cagaaggaactgaagaaggaggtcatggagcacaggctggtgttggacaccgtgaatgag
gtgagccatgcgctcctagagctggtgccttggagagccagagaaggactggataaactt
gtgtctgatgccaacgagcagtacaaactggtcagtgacaccgttggacaaagggtagat
gaaattgatgctgctattcagagatcacaacagtacgagcaagctgctgatgcagaacta
gcttgggttgctgaaacaaagcgaaagctaatggcgcttggtccaattcgtctagaacaa
gaccagactactgctcagctgcaggtacaaaaggctttctccattgacatcattcgacac
aaagactccatggatgagctcttcagtcaccgtggagagatctttagcacatgtggggag
gagcagaaggctgtgctgcaggagaagaccgagtgcctaatacagcaatatgaagccgtt
agcctgcttaactcagagcgctatgctcgcctagagcgagcacaggtcttagtgaaccag
ttttgggaaacgtacgaagagctcagcccctgggctgaggagaccctagcgttgatagca
cagctgccgcctcctgctgtggaccatgagcagctcagacagcagcaggaagagatgagg
caactaagggaatccattgctgaacacaaacctcatattgataagatactaaagataggt
ccacaactgaaggagctaaaccctgaagaagggaaaatggttgaagaaaaataccagaaa
gcagaaaacatgtatgcccaaataaaagatgaggttcgccaacgggccctggctctggat
gaggctgtgtcccagtctgctcagtttcatgataaaattgaacccatgttggagactctg
gagaatctgtcctctcgcctgcgaatgccgcccctgatccctgctgaagtagacaagatc
agagagtgcatcagtgacaataaaagtgccaccatggagctggaaaaactgcagccatcc
tttgaagccctgaagcgtcggggagaggaactcattgggagatcacagggagcagacaag
gatttggctgcaaaagaaatccaggacaagctggatcaaatggtattcttttgggaggac
attaaagcacggtctgaagagcgagaaattaaattccttgatgtccttgagttagcagag
aagttctggtatgacatggcagccctcctgaccaccatcaaagacacacaggagattgtc
catgacctggaaagccctggcattgacccatccatcatcaagcaacaggttgaagctgct
gagactattaaggaggagacagatggtctgcacgaggagttggagttcattagaatcctt
ggagcagatttgatttttgcctgtggggaaacggagaagcctgaagtgaagaagagcatt
gatgagatgaataatgcttgggagaacttaaatagaacttggaaagaacgactagaaaag
ctcgaggacgcgatgcaagctgctgtgcagtatcaggacacgctccaggccatgtttgac
tggctggataacactgtaatcagactctgcaccatgcccccagtgggcactgacctcaac
actgtcaaagatcagctgaacgagatgaaggagttcaaagtagaagtttaccaacagcaa
attgagatggagaaactcaatcaccagggtgaattgatgttaaagaaagctactgatgaa
actgacagagatattatacgagaaccactgacagaactcaaacacctctgggagaatctg
ggtgagaagattgcacatagacagcataagctggagggcgctctcttggccctcggccag
ttccagcatgccctagaagagctgatgggttggctgactcacactgaggagctgctggat
gctcagaggccaataagtggagacccaaaagtcattgaagttgagcttgcaaagcaccac
gttctaaaaaatgatgttttggctcatcaagccacagtggaaacagtcaacaaagctggt
aatgaactccttgagtctagtgctggagatgatgccagcagcctaagaagccgcctggaa
accatgaaccagtgctgggaatctgtgctgcaaaagacagaggagagggagcagcagttg
cagtcaactctgcagcaggcccagggtttccacagtgaaattgaagagttcctcttagaa
ctcaatagaatggagagccaactttctgcatctaaacctacaggaggactcccggagacg
gctagagaacagcttgatgcgcacatggaactgcattcccagctgagagccaaggaggag
atttacaaccagttgcttgacaagggcaggcttatgctcctcagccgtggtgattctggg
tctggctcaaaaacagagcagagtgtagcgctcttggaacagaagtggcatgtggtcagc
agtaaggtggaggaaagaaagtcaaagctcgaagaggccctcagcctggcaacagaattc
cagaattccttgcaagaatttatcaactggcttactctagcagagcagagtttaaacatt
gcctctcctcccagcctgattttaaacactgttctttcccagatagaagagcacaaggtt
tttgctaatgaagtaaatgctcatcgagaccagatcattgaactggaccaaacagggaac
cagttgaagtttcttagtcagaaacaggatgttgtcttgatcaagaatttgttagtcagt
gtccagtctcggtgggagaaggttgtccagcggtctattgaaagggggcggtcactggat
gatgccaggaagcgagccaagcaattccatgaagcttggaaaaagctgattgactggcta
gaagatgcggagagccatctggactcagaactggagatctccaatgacccagacaaaatc
aagcttcagctttccaaacacaaggaatttcagaaaactcttggtggcaaacagcctgtg
tatgacaccaccatcagaactggcagagcactaaaagaaaagactttgcttgctgacgat
gctcagaaacttgacaacttgctaggagaagtcagagacaaatgggacactgtctgtggc
aagtctgtggagcgacagcacaagttggaagaagccttactgttttcaggccaattcatg
gatgctttgcaggctttagttgactggttgtacaaggtagagccacagttggctgaggac
cagcctgtacacggggaccttgacctcgtcatgaacctcatggatgctcataaggttttc
caaaaagaactgggaaagagaaccggcaccgttcaggtcctgaagcggtcaggcagagaa
ctgattgagagcagcagagatgacaccacatgggtaaaggggcagctccaggagcttagc
acacgctgggatacagtgtgcaaactctctgtttccaagcaaagccggcttgaacaggcc
ttaaaacaggcagaagagtttcgggacaccgtccatatgctgttggagtggctttctgaa
gcagaacaaacacttcgctttcgaggggcccttcctgatgatacggaggccctacagtct
ctcattgacacccataaggaattcatgaagaaagtagaggaaaaacgggtagatgtgaat
gcagcagtggcgatgggagaagtcatcctggctgtctgccatcctgattgcatcacgacc
atcaagcactggatcaccatcatccgagctcgcttcgaggaggttctgacatgggcaaag
cagcaccagcagcgcctggaaacagctctgtcagaactggtggctaatgccgagctcctg
gaagaacttctggcgtggatccagtgggccgagaccaccctaatccagcgggatcaggag
cctatccctcagaacatagacagagttaaagctcttatcaccgagcatcagtcatttatg
gaggagatgacacgcaaacaacctgatgtggaccgggtcaccaagacatataagaggaag
aatatagaacccacccatgctcctttcatcgagaaatcccgcagtggtagcagaaagtcc
ttgaatcaacccacacctccacccatgccaatcctctcacagtctgaagcaaaaaaccca
cgaatcaaccagctctctgcccgctggcagcaagtatggctgttagccctggagcgccag
cggaagctgaacgatgccttggatagactggaggagctatgcccggaattgaaggaattt
gccaactttgactttgatgtctggaggaaaaagtatatgcgttggatgaatcacaaaaag
tctcgagtcatggatttcttccggcgtattgacaaggaccaggatgggaaaataacacgt
caggagtttatcgatggcattttagcatctaagttccctaccaccaagttagagatgaca
gctgtggctgacatttttgacagagatggggatggctacattgactactatgaatttgtg
gctgccttacatcccaacaaggatgcctatcgaccaacaactgatgcagataagattgag
gatgaggtgacaagacaagtggctcagtgcaagtgtgcgaaaagattccaagtggagcag
attggcgagaataaatatcggttcttcctcggcaatcagtttggagattctcagcagttg
cggctggtccgtattctgcgcagcactgtgatggtccgcgttggtggaggatggatggcc
ctggatgagtttctagtgaaaaacgatccctgccgagcacggggcagaactaacatagaa
cttagagagaaattcatcctgccagaaggggcatctcaggggatgactccattccggtca
cggggtcgaagatccaaaccatcttcccgggcagcttctcccacccgctccagctcaagt
gctagtcagagtaaccacagctgtacgtccatgccttcttctccagccaccccagccagt
gggaccaaggttatttcatcaacaggcagcaagctgaaaagaccaacaccaacttttcat
tctagccgaacatcccttgctggtgacaccagcaatagttcttccccagcttccacaggt
gccaaaactaatcgggcagaccctaagaagtctgccagccgtcccgggagtcgggccggg
agccgggccgggagccgagccagcagccgtcgaggaagtgacgcctctgactttgacctt
ctagagacacagtcagcgtgttcagacacttctgagagcagtgccgcaggggggcagggc
agctccagaagagggctcaccaaaccctccaaaatcccaaccatgtctaagaagaccacc
actgcctcccccaggactccatgtcccaagcgataa

DBGET integrated database retrieval system