KEGG   Rattus norvegicus (rat): 362708
Entry
362708            CDS       T01003                                 

Gene name
Trim54, Rnf30
Definition
(RefSeq) tripartite motif-containing 54
  KO
K10653  tripartite motif-containing protein 54
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362708 (Trim54)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    362708 (Trim54)
SSDB
Motif
Pfam: zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-RING_2 zf-B_box zf-C3HC4_4 zf-C3HC4_3 zf-RING_6 UvrD_C DUF5799 DUF1421 DUF349
Other DBs
NCBI-GeneID: 362708
NCBI-ProteinID: NP_001013235
RGD: 1306453
Ensembl: ENSRNOG00000006146
UniProt: Q5XIH6
Position
6q14
AA seq 364 aa
MNFTVGFKPLLGDAHNMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQKFETLCAVLEERKGELLQALARVQE
EKLQRVRSLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAG
RPEPGYESMEQFSVIVEHVAEMLRTIDFQPGASGDEEDDEVTLDGEEGNTGLEEERLDGP
EGLH
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgaacttcacggtgggtttcaagccgctgctgggggatgcacacaacatggacaacctg
gagaagcagctcatctgccccatctgcctggagatgttctccaagcccgtggtgatcttg
ccgtgccaacacaacctgtgccgcaagtgtgccaacgacgtcttccaggcctctaaccct
ctgtggcaatcccggggctccacaactgtgtcttcaggaggacgtttccgctgcccatct
tgtaggcacgaggttgtcctggaccggcatggcgtctacggcctgcagcggaacctgcta
gtggagaatattattgacatctacaaacaggagtcctcccggccactgcactccaaggct
gaacagcaccttatgtgtgaggaacatgaagacgagaagattaacatctactgtctgagc
tgtgaggtgcccacctgctctctctgcaaggtctttggcgcccacaaggactgtgaggtg
gcccctctgcccaccatttacaaacgccagaagagtgagctgagtgacggcatcgcgatg
ctggtggcaggcaacgaccgtgtgcaggcagtgatcacgcagatggaggaggtgtgccag
accattgaggacaacagccgcagacagaaacaactgttaaaccagaagttcgagaccctg
tgcgcggttttggaggagcgcaagggcgagttgcttcaagcgctggctcgggtgcaagag
gagaagctgcagcgcgtgcgtagcctcatccgccagtacggagaccacttggaggcctcc
tctaagctggtggagtccgccatccagtccatggaggagccgcagatggctctctacctc
cagcaggccaaggagctgatcaacaaggtcggggcaatgtcgaaggtggagctggctgga
cggccggagccaggctatgagagcatggagcaattctctgtgatcgtggagcacgtggcg
gaaatgttgcggaccatcgacttccagccgggcgcctctggggatgaagaggatgacgag
gtgactttggacggggaagagggcaacacagggctggaggaggagcggctggacgggcca
gaaggtttgcactga

DBGET integrated database retrieval system