KEGG   Rattus norvegicus (rat): 362724
Entry
362724            CDS       T01003                                 

Gene name
Sh3yl1
Definition
(RefSeq) SH3 and SYLF domain containing 1
  KO
K20523  SH3 domain-containing YSC84-like protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362724 (Sh3yl1)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    362724 (Sh3yl1)
SSDB
Motif
Pfam: Ysc84 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 362724
NCBI-ProteinID: NP_001102175
RGD: 1306440
Ensembl: ENSRNOG00000005522
UniProt: B0BNA1
Position
6q16
AA seq 340 aa
MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAVLSVIKAGFLVT
ARGGSGIVLARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNL
TLGGNFTVAVGPLGRNLEGNVSLRSSAAVFTYCKSRGLFAGISLEGSCLIERKETNRKFY
CQDIRAYDILFGDVPQPAQAEDLYEILNSFTEKYETEGQRINLKKVAREQRKAKELPPKP
SSRPQPSRPPVQLNAGSQSNRNEYKLYPELSSYHEKTGSLSQPIEVTALYSFEGQQPGDL
NFQAGDRIIVISKTDSNFDWWEGKLRGQTGIFPANYVTMN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaataacccaataccttctaatctgaagtcagaagcaaagaaggctgccaaaatatta
agagaattcacagaaataacttccagaaatgggcctgataagatcattcctgcccatgtg
attgcaaaagcaaaaggtcttgcagttttgtctgtgattaaagccgggtttctggtcaca
gccaggggaggcagcgggatcgtcctggcacgtcttccggatggaaaatggtctgctcct
tcagccattgggatagctgggctcggtggaggatttgaaataggaatagaggtgtcagat
ttggtgataattctgaattatgacagagctgtagaagcctttgcaaagggcggaaacctg
accctcggagggaattttactgtggcagttgggcccctaggcaggaacctggaaggcaac
gtgtccctgaggagctctgcagccgtcttcacgtactgcaaatcccggggcctctttgct
ggtatttccctagaaggaagctgtctgattgaaaggaaagaaactaatcggaaattttac
tgtcaggacatccgcgcttatgacatcttatttggggatgtcccacagcctgctcaagca
gaagacctgtatgaaatccttaattccttcactgaaaagtatgaaactgaagggcagcgc
atcaatctgaagaaagtggctcgggagcagaggaaggccaaagaactacctccaaaacca
tcatcaaggccacagccatcacgcccacctgtgcagctgaatgccggctcccagagtaat
agaaatgaatataagctatatcctgagctttctagctatcatgagaaaactggcagtttg
agtcagccaatagaagtgacagcattatactcttttgaagggcaacagcccggggacttg
aattttcaagcaggagacagaatcatagttatatcaaagaccgactcaaattttgattgg
tgggaaggaaaacttcgaggtcaaactggaattttcccagccaactatgtaactatgaat
taa

DBGET integrated database retrieval system